(data stored in ACNUC7421 zone)

EMBL: CP001720.PE481

CP001720.PE481       Location/Qualifiers
FT   CDS_pept        540067..540759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61446"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR021617"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61446.1"
FT                   /translation="MLQLGITADLVMSGNYQALYEFLQLCLCVRAKWCNKMNIYIKHVT
FT                   VYDIGLRYLNHARGERMKLGLLDKIIKQEDIDSGIHSGESYIIWTQIVARYDTLELVDV
FT                   ILNFSNDLDFKLLVKRGIDKVIKPQLNQLIEKAKYYRLPLPPRPPESQNLSSNMETFRD
FT                   EFLYKLLMDGSQTGLDVHLKAIKICINDALRDMFMEFILQEMKLYDELIKYGKVKGWLE
FT                   NAPIYKNN"
     atgttgcagc tcgggatcac cgctgactta gtaatgtccg ggaattatca ggcattatat        60
     gaatttctcc aactttgcct atgtgtgagg gctaaatggt gtaataagat gaatatttat       120
     attaagcatg tgacagttta tgatataggc ttaagatatt taaatcatgc aaggggtgag       180
     agaatgaagt tgggattgtt agacaaaata ataaaacagg aagatattga ctcgggtatt       240
     cattccggtg aaagctacat tatttggaca caaatcgttg ctagatatga tactttggaa       300
     ttagtagatg ttatcttgaa tttttctaat gatttggatt ttaaacttct tgtaaaaaga       360
     ggaatagata aagtaataaa gcctcagtta aatcaactta tagaaaaagc taaatattat       420
     agattgcctc ttcctcccag accgcctgag agtcaaaatt tatcatcaaa tatggaaact       480
     tttagagatg agttcttata taaactgctg atggatggta gtcagacagg ccttgatgtt       540
     caccttaagg ccattaaaat atgcattaac gatgctttga gagatatgtt tatggagttt       600
     attctgcaag aaatgaaatt gtacgatgag ctaattaagt atggaaaagt taagggatgg       660
     ttagaaaatg caccaattta taaaaataat taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page