(data stored in ACNUC7421 zone)

EMBL: CP001720.PE484

CP001720.PE484       Location/Qualifiers
FT   CDS_pept        complement(543338..543769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0529"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: vok:COSY_0678
FT                   negative regulator of ferric iron uptake"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61449"
FT                   /db_xref="GOA:C8W5Z4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV61449.1"
FT                   /translation="MLNRAYHLLKECNLRITLQRKAILEILYNCRGHHLEAENIYGLLT
FT                   VQDNNKRIGLATVYRTMELFEKIGIVSRLSMENSSARYELVMFDRLMHHHLICLKCGQL
FT                   TELDDRMAEEFKNRISEEKGFEVADKSMKIYGYCSSCKG"
     ttgcttaacc gggcctatca tttgcttaag gaatgcaatt taaggattac gctgcaaaga        60
     aaagctatcc ttgagattct atacaattgc aggggacatc atcttgaagc tgaaaatatt       120
     tatggacttc ttacagtaca agataataat aaaaggatag gactggcgac ggtgtatcgt       180
     accatggaat tattcgaaaa gattggtata gtgtcaagat tatcaatgga aaactcatcg       240
     gcacggtacg agttggtaat gtttgacagg ttaatgcatc accatttaat ttgtttaaaa       300
     tgcggacaac tgacggaatt agatgataga atggctgaag aattcaaaaa ccggatttcg       360
     gaagaaaaag gatttgaggt tgctgataaa tcaatgaaaa tttacggata ctgtagcagt       420
     tgtaaagggt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page