(data stored in ACNUC7421 zone)

EMBL: CP001720.PE485

CP001720.PE485       Location/Qualifiers
FT   CDS_pept        complement(543954..544178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0530"
FT                   /product="peptide deformylase"
FT                   /note="KEGG: bph:Bphy_0035 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61450"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_0035"
FT                   /protein_id="ACV61450.1"
FT                   /translation="MALRNIMNYQTNDILRKKTRTIEKFYNRILTSLKNMAETMYNANE
FT                   TGLAATQVAILRRLVVIDVGTGSINPVIS"
     atggcgttgc gaaacattat gaattatcag acaaatgata tattgcggaa aaagacaaga        60
     acgattgaaa aattttacaa taggatactg acatcgctta agaatatggc tgaaaccatg       120
     tataatgcaa acgaaaccgg gttggcggcc acccaagttg ccatattacg acgacttgtt       180
     gtaattgacg ttggaacagg gtctattaat ccagttatca gttaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page