(data stored in ACNUC7421 zone)

EMBL: CP001720.PE487

CP001720.PE487       Location/Qualifiers
FT   CDS_pept        complement(544707..544874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0532"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dal:Dalk_3511 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61452.1"
FT                   /translation="MAALVNKEKCIGCGQCEDVCPVGAIKLEDGKAVISDECVECGTCV
FT                   EECPNEAISL"
     atggcagctt tagtaaacaa ggaaaaatgc attggctgcg gccaatgcga ggatgtgtgc        60
     cctgtagggg caatcaaact tgaagatggt aaggcagtca tcagcgacga atgtgttgaa       120
     tgcggtacat gtgttgaaga atgtccaaat gaagcaataa gtttatag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page