(data stored in ACNUC7421 zone)

EMBL: CP001720.PE489

CP001720.PE489       Location/Qualifiers
FT   CDS_pept        546964..547848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0534"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number="1.5.1.20"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   dol:Dole_2330 methylenetetrahydrofolate reductase
FT                   (NAD(P)H)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61454"
FT                   /db_xref="GOA:C8W5Z9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z9"
FT                   /inference="protein motif:PRIAM:1.5.1.20"
FT                   /protein_id="ACV61454.1"
FT                   /translation="MKLSEIFKTGKPTLSFEFFPARNEKAAETFNQTIEDLVELKPDFV
FT                   SVTFGAGGSTKEGSYELVKKLKKEKELEVVAYLAAFALKKDEINAVLNSYQDLGIENIL
FT                   ALRGDPPKDADVTQVSAESFKYASELAAFIHQNYSFCLGVAGYPEGHIEAPSLKKDIEY
FT                   LKHKVDQGVDFIIAQFFYDNVCFFDFRERCQKSGINIPVLPGIMPVYSVKMMEMLAGSC
FT                   GAKIPEKLRKGISELPEGDTKALVDFGIEYATGQCEELLKEGARGLHFYTMDKSESTVG
FT                   IVKGLRNRGFLTI"
     atgaaactat cagaaatctt taaaacaggt aaacccacgc tctcttttga gtttttccct        60
     gcccgtaatg aaaaagctgc tgaaacgttt aatcaaacga ttgaagatct tgttgaatta       120
     aagcctgatt ttgtttcagt tacattcggc gctggtggat cgaccaaaga aggttcttat       180
     gagttggtta aaaagttgaa gaaagaaaag gaactggaag tggttgctta tcttgcggct       240
     ttcgctttga aaaaggatga gataaacgcc gtgctgaaca gctatcagga tctcggcatc       300
     gagaatattt tagcactgcg cggggatccg cccaaagacg cagatgttac acaggtgtcg       360
     gctgaaagct ttaaatatgc ctcggagctc gcagcattta ttcaccaaaa ttacagcttt       420
     tgtctggggg ttgccggata tccggagggc cacatcgaag cgccaagcct taagaaggac       480
     attgaatacc ttaaacacaa ggttgatcaa ggtgtcgatt ttattattgc ccaatttttc       540
     tatgacaatg tttgtttttt tgattttagg gagcgttgtc agaaaagcgg tattaatatt       600
     cctgtattgc ccggaatcat gccggtttac agtgttaaaa tgatggaaat gttagccgga       660
     agctgcggtg ctaagatacc ggaaaaatta agaaagggga tatctgagtt gcctgagggc       720
     gatacgaagg cgcttgttga cttcggaatt gaatacgcga cagggcaatg cgaagaactt       780
     cttaaagaag gcgcccgtgg attgcatttt tataccatgg ataaaagcga atccacagtg       840
     ggtattgtga aaggacttag aaatagagga tttttaacta tttag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page