(data stored in ACNUC7421 zone)

EMBL: CP001720.PE49

CP001720.PE49        Location/Qualifiers
FT   CDS_pept        57041..57463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0051"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   bsu:BSU37340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61014"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE5"
FT                   /inference="protein motif:PFAM:PF09148"
FT                   /protein_id="ACV61014.1"
FT                   /translation="MRKEVLVTVRGTQTNDFGEQDTIELVTMGSYYLKNSSYYIVYNET
FT                   ELSGMEGTVTSVKAEADKVTVNRMGTSEMKHVFEEGVPDEGSYVTPFGQLFTSVFPRKV
FT                   EVDLTDVGGSINLEYELALDRQRIGYNELCITVKEV"
     atgcgtaaag aggtgttggt gactgtgcgt gggactcaga ccaatgattt tggggagcaa        60
     gatactattg aactggtaac tatgggcagt tactatttaa agaacagcag ttactatatc       120
     gtttataacg aaacagaatt atcaggcatg gaagggactg tgacctcggt taaggcggaa       180
     gcggataaag tgactgttaa ccgaatgggt acttctgaaa tgaagcatgt ttttgaggaa       240
     ggagtaccgg atgaggggag ttatgttaca ccctttggcc agttattcac cagtgttttc       300
     ccaaggaaag tggaggttga cttgacagac gttgggggaa gtattaatct ggagtatgaa       360
     ttagcattag acaggcagag aataggctat aatgaattat gtattactgt caaggaggtc       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page