(data stored in ACNUC7421 zone)

EMBL: CP001720.PE492

CP001720.PE492       Location/Qualifiers
FT   CDS_pept        550091..550792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0537"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mno:Mnod_0192 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61457"
FT                   /db_xref="GOA:C8W602"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C8W602"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACV61457.1"
FT                   /translation="MPNKKGKFKVGQIFTSIIVSLLFIAVILFLAGDWFWIEGWVFIVF
FT                   WLTMTLSIGIYLSVNDPELLAERSKMPGSDNQKGWDKYYQSFAYVSLIAWVIIMPLDAK
FT                   RYAWSPYFPVWLKAIGGVALLPSLYFLFQSVATNTFASTMVRIQTERKQHVISTGVYGF
FT                   VRHPMYLGNLLMLVGTPLMLGSIYGLIIGLIGIFLMAVRIIGEERMLINELEGYEDYKK
FT                   KIRYRLIPFVW"
     atgccaaata aaaaaggcaa atttaaagtt ggccaaattt tcacgtcaat aattgttagt        60
     ttactattta tagcagtcat tcttttcctt gcaggtgatt ggttttggat agaaggttgg       120
     gtttttattg tattttggct tactatgact ttatctattg gtatttatct gtctgttaat       180
     gaccctgaat tattggccga gcggtctaaa atgcctggtt ccgacaacca aaaaggatgg       240
     gataaatatt atcaatcctt tgcttatgta tcccttatag catgggttat cattatgcca       300
     ttagatgcca aaagatatgc atggtcgccc tactttcctg tatggttaaa agcaattggt       360
     ggagtggcat tgttaccatc tttatacttt ttatttcaat cagtggctac gaatactttc       420
     gcttcaacaa tggtcaggat tcagactgaa cgaaaacaac acgtaatttc cacaggcgtt       480
     tatggattcg taagacatcc catgtatctt ggcaatttat taatgcttgt agggacacca       540
     ctgatgctgg gttcgatcta tggcttaata ataggattaa ttgggatttt tcttatggcg       600
     gtcagaataa tcggtgaaga gagaatgtta atcaatgaat tagagggtta cgaagattat       660
     aagaagaaga tacgatatag acttataccc ttcgtttggt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page