(data stored in ACNUC7421 zone)

EMBL: CP001720.PE493

CP001720.PE493       Location/Qualifiers
FT   CDS_pept        551136..552071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0538"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0568 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61458"
FT                   /db_xref="GOA:C8W603"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W603"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61458.1"
FT                   /translation="MKKIKLILKRLLQIIPMLIIVTILAFALSNMSSGDVAEVTIRSQG
FT                   LEVTEKNVAAAREELGLNAPLHIQYINWLKKAVKFDFGISFQTKKPVSDEILSRFPATL
FT                   KLAIAATVISILFAIPAALISARYKDSLIDHLFRIASTFGATLPDFWLGLMLLYVFAVQ
FT                   LNIFPVISGNKLQNIFLPAFTLSVNYGAIYMRVLRNNLIEITNYDYMRAARARGLSRNA
FT                   VLLKHGLKNAVLPCITLIGVDFGKLLAGQFACETIFSWNGIGEFAIDSIKLKDLPVIQG
FT                   YIMIVAVTFIAVNLLLDILYLYIDPKIQLK"
     atgaagaaaa ttaaactaat tttaaagcga ttgctgcaaa taatccctat gttaataata        60
     gtcactattt tggcttttgc tttaagtaat atgtcatcgg gtgatgttgc agaggtaact       120
     atccgcagcc agggcttaga ggttacagaa aagaatgttg ctgcagcacg ggaagagttg       180
     gggttaaatg caccgcttca tattcagtat attaattggt tgaaaaaagc ggttaaattt       240
     gattttggta tatcattcca aacaaaaaag cctgtttcag atgaaatact atcgagattt       300
     cccgctactc ttaagctagc tattgcagcg acggttattt caatactatt tgcaattccg       360
     gcagccctta tttcagccag atacaaggat tcactgattg accacctatt cagaatcgca       420
     tctacttttg gtgcaacatt gccggatttc tggctcggtc taatgcttct atatgttttt       480
     gcggttcagt tgaatatctt tcctgttatt tccgggaata aattgcaaaa catatttctt       540
     ccggctttta cgcttagtgt aaattatggt gccatatata tgcgggtttt gagaaacaat       600
     ctcatagaaa taactaatta tgactatatg agagctgcaa gagcaagagg tttaagccga       660
     aatgccgtat tgctaaagca tggattaaaa aacgctgtac tcccatgcat aactcttata       720
     ggtgtagact ttggaaagct tttggcaggt caatttgctt gtgagaccat cttttcttgg       780
     aacggaatag gggaattcgc gattgacagt attaaactaa aagatttacc tgttattcaa       840
     ggatatataa tgatcgttgc agtaactttt attgccgtaa atcttttgct tgatatttta       900
     tatctttata tagaccctaa gatacaactt aaataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page