(data stored in ACNUC7421 zone)

EMBL: CP001720.PE495

CP001720.PE495       Location/Qualifiers
FT   CDS_pept        553041..553826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0540"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH0350 oligopeptide ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61460"
FT                   /db_xref="GOA:C8W605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W605"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61460.1"
FT                   /translation="MAEQPILSIKNLKTYFYLVERVVKAVDGISLDVYKARITAIVGGS
FT                   GSGKSVMSLSIFNLIDDPGKIIDGEIWLNGVNIRNLKEKQLLKIRGKEISMIFQEPTSS
FT                   MNPVLKVKKHLFEVIHTQNKAIRNKEALSMFRDVLSRVGLKNTEQILESYPFELSGGMC
FT                   QRVMVAMGLLANSRVLIADEPTSSLDLTTQAAILEELVRLKNEGMAIVLITHDLGVVAQ
FT                   MADDVYVIKDGKIVESGTVYDVFESPKHEYTKSLLNSIF"
     atggccgaac agcctattct atcaataaaa aatcttaaaa cctattttta tttagtagaa        60
     cgagtggtaa aagctgtaga tggaatcagt cttgatgtat acaaggccag aataacagca       120
     attgtaggcg gctccggcag cggaaaatcg gttatgtcat tatcgatctt caatttgatc       180
     gacgatccgg gaaagattat tgacggagaa atatggctta atggggttaa catcagaaat       240
     ttgaaagaaa aacagctttt aaaaataaga ggcaaagaaa tttccatgat atttcaagaa       300
     ccgactagtt caatgaatcc tgttctgaag gtaaaaaaac atctttttga ggtaatccac       360
     acacaaaata aagcgattag aaataaagag gctctaagca tgttccgaga tgtgctttca       420
     cgtgtcggtt taaaaaatac tgaacaaatt ctggaaagtt atccttttga actaagcgga       480
     ggtatgtgcc aaagagttat ggtagcgatg ggattgcttg caaattcccg tgtattaata       540
     gcagacgaac cgacctcatc actggattta acaacgcagg ccgccatact cgaagaattg       600
     gtacgcctca aaaacgaagg tatggccatt gtcttgataa cccatgattt aggggtggtt       660
     gctcagatgg cggatgacgt ttatgtgata aaagacggaa aaatagtaga aagcggcaca       720
     gtttatgatg tgttcgaatc gccaaagcat gagtatacta agtctctgct taattcaatt       780
     ttttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page