(data stored in ACNUC7421 zone)

EMBL: CP001720.PE496

CP001720.PE496       Location/Qualifiers
FT   CDS_pept        553789..554796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0541"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: aha:AHA_3428 oligopeptide transport ATP-
FT                   binding protein AppF; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61461"
FT                   /db_xref="GOA:C8W606"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W606"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61461.1"
FT                   /translation="MSILSLCLIQFFNLKKGESVNLLEIKGVYKCYNEKQKPKVYAVHN
FT                   ISLNIKKGEILGLVGESGCGKSTLGKMLLKLEQPTRGRIIFNRHDITDYSFNQMRKIRN
FT                   SMQMIFQGTANAFNPYFTVKQIISEPLNNYSSESAEEKEKKIVAMLEKVGLNHTYLTRY
FT                   SQEMSGGQRQRVGIARALILNPEFVVCDEAVSSIDYALKRQILTLLIDLKRQFDLTYLF
FT                   ISHDISAVNKICDRVVVMYLGNIMEIISGINDKVQHPYTKALLAATLVPDPKKRSKNMV
FT                   LLREGEELKIPEKGCVFQNRCLYTQEVCKTKQPALVPHNDEHYIACHFCCKNRI"
     atgagtatac taagtctctg cttaattcaa ttttttaatc tgaaaaaggg tgaaagcgtg        60
     aatttattag aaataaaagg cgtttataaa tgctataacg aaaaacaaaa gccaaaggtt       120
     tatgccgtac acaatataag tttaaacata aaaaaaggcg aaattctggg tcttgtcggt       180
     gagtcgggct gtggcaaaag cactttgggg aaaatgcttt taaaactgga acagcctacc       240
     agaggaagga tcatttttaa ccggcatgat ataacagatt actcctttaa tcaaatgcga       300
     aaaatcagaa acagcatgca gatgatcttt caaggaaccg ctaatgcttt taacccttat       360
     tttacggtaa agcaaataat tagtgaacca cttaacaatt acagtagcga atcggcagag       420
     gagaaagaaa aaaaaatcgt tgccatgctg gagaaagtag ggcttaacca tacgtatctg       480
     actagataca gccaggaaat gtccggaggc caaagacaaa gggtaggcat tgccagagcc       540
     ttgatcctga atccggaatt tgttgtgtgc gatgaagcag tttccagcat tgattatgca       600
     ctaaagagac aaattttaac tcttttgatc gacctgaagc ggcaatttga tctcacatac       660
     ttatttattt ctcatgatat atcagcggtt aataagatat gtgacagagt agtagttatg       720
     tatctgggaa atattatgga aattatatcc ggtattaatg acaaagtaca gcacccttat       780
     acaaaagcac ttcttgctgc aactcttgtt cctgatccta aaaaaaggtc gaaaaatatg       840
     gtgctgctta gagagggtga agaattaaaa atacctgaga agggatgtgt ttttcagaat       900
     cgctgtcttt atacacaaga agtatgcaaa accaagcaac cagcgctagt gccgcataat       960
     gacgagcatt atattgcctg ccatttttgt tgcaaaaata gaatttaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page