(data stored in ACNUC7421 zone)

EMBL: CP001720.PE497

CP001720.PE497       Location/Qualifiers
FT   CDS_pept        554810..556423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0542"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH0567 nickel transport system (nickel- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61462"
FT                   /db_xref="GOA:C8W607"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W607"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61462.1"
FT                   /translation="MRKNIIATITLLICTCLIISACGKNDSVSSKPGVKEVVVAIYRDG
FT                   AMGELDAATYNGPHFLYKMIYDGFVEDGGDGKILPQLATSWIISPDGKTYTFKLRKGVK
FT                   FSDGTDFNADAVIFNLKRWVNNKRHAILKSVNVESMEDVDNDTVKIVFKDGAYPILTEL
FT                   TYPRPVRFLSPSSVTAVAGDVMGKFTKPVGTGPWMLESYKKDQEFTLVPNPYYWGEKPK
FT                   LDRITFKVITDGQARVLALQSGEVDILGGDLVSKIPMESFLELKNSGKFTTYTKGTMCS
FT                   HFISFNQKVEAFQDRNVRLAMNYAINKKSIVTDLFDNIGFEANGLYQKGVPYTTDENNY
FT                   GFANDKEKAKQLFDTAGYVDTNGDGIRDKNGKNLEFNFVLSTEEFPEWKPLAEFVQSEF
FT                   SSVGIKVNLNIMDKNGYEDATMNTKAFDIALMRTSSDSWVPHGSMLELFSILSTSNAAK
FT                   AWYDEGLYNNIIKTLNSIDERERQKNYDKVFKFISEEALTIPIYYPITSFAVNSDKIKG
FT                   FEIGVNSYAPIEWQKLDVKQ"
     atgagaaaaa acattatagc aaccattacg ctattaattt gcacctgctt gatcatttct        60
     gcttgcggca aaaatgattc agtatcaagc aaaccgggag taaaggaagt tgttgttgcg       120
     atttatcgtg atggggccat gggggaattg gatgccgcaa cctataatgg acctcacttt       180
     ttgtacaaga tgatttatga cggttttgtt gaagatggag gagatggaaa gatccttcct       240
     cagcttgcaa caagctggat catttcaccg gatggaaaaa catacacgtt taagctccgt       300
     aaaggagtga aattttctga tggaaccgat ttcaacgcag acgctgttat attcaacctg       360
     aaaagatggg tcaacaacaa acgtcatgcg atcttgaaat cggtcaatgt agaaagtatg       420
     gaagacgttg ataatgacac agtaaaaatt gtttttaagg acggtgccta tccaattttg       480
     acggagctga catacccaag gccagtacga tttttaagcc cttcatcagt tactgcggtt       540
     gccggagatg ttatgggtaa atttacaaag cctgtcggca caggtccatg gatgctggaa       600
     tcctataaaa aagatcagga atttactctt gttcctaatc catactactg gggtgaaaaa       660
     cctaagctgg acagaataac atttaaggta ataacagatg gacaagcaag agttttagct       720
     cttcaaagcg gtgaggttga tattctcgga ggtgatcttg tctcgaagat ccccatggag       780
     agttttttag agcttaaaaa ctcgggtaag tttacaacat acacaaaagg aacaatgtgc       840
     tcgcacttta tttccttcaa tcaaaaggtg gaagcatttc aggatagaaa tgttcgttta       900
     gccatgaact atgccatcaa taaaaaaagc attgtaacag atctttttga caatattggt       960
     tttgaggcga atggcttata tcaaaaaggc gttccttaca ctacagatga aaataattac      1020
     ggatttgcaa atgataaaga aaaagcgaaa caattatttg atactgccgg atatgtagat      1080
     acaaacggtg acggtattcg tgataagaac ggaaagaatc ttgagtttaa ttttgtatta      1140
     tcaacagaag aatttcctga atggaagccg ctggccgagt ttgtgcaatc tgaattttca      1200
     tcagttggca taaaagtaaa tcttaatatt atggataaaa acggatacga ggacgcaacg      1260
     atgaatacta aggcatttga catcgctctt atgagaacat cttcggattc ctgggtgccg      1320
     cacggttcaa tgctggagct tttctcaatt ctttctacaa gcaatgccgc aaaggcctgg      1380
     tatgatgagg gactctataa caacattata aaaacattga acagcattga cgaaagagaa      1440
     agacaaaaga attacgataa ggtattcaaa ttcatcagcg aagaagctct cacaattcct      1500
     atttactatc ctataacttc attcgctgtt aattctgata aaataaaagg atttgaaatc      1560
     ggagttaata gctatgcacc gatagaatgg cagaagcttg acgtaaaaca ataa            1614
//

If you have problems or comments...

PBIL Back to PBIL home page