(data stored in ACNUC7421 zone)

EMBL: CP001720.PE498

CP001720.PE498       Location/Qualifiers
FT   CDS_pept        556497..557240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0543"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61463"
FT                   /db_xref="GOA:C8W608"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W608"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61463.1"
FT                   /translation="MDREQKLIKNWTDSSNNYSNIIKEELNSFKKKAWTDIILNNAGKN
FT                   TKMDILDVGTGPGFFTIIMSQVGNNVTAIDCTEAMINEARANAKSEGVTASFRVSDGQN
FT                   LEFDDESFDLIISRNVAWTLIDAEKAYSEWKRVLKTDGKIIMFDANWNIRLFNEAYMEK
FT                   YMEDQKEYVRLFGEEPPQYTAEMIDFRKSMPMCQRIRPQWDFNKLLELGYKKIYCETDI
FT                   GDRVYNEKERVINRSTPMFMLVVEK"
     atggatcgtg aacaaaaact gataaaaaat tggacggaca gttctaacaa ctacagcaac        60
     ataataaaag aagagttaaa cagctttaaa aagaaagcat ggactgatat tattcttaat       120
     aatgccggaa aaaacacaaa aatggatatt cttgatgtag gtactggccc gggttttttt       180
     accataataa tgtcgcaggt ggggaacaat gtgactgcta ttgattgtac cgaggcaatg       240
     attaatgaag caagggcaaa tgcaaaaagc gaaggtgtaa ctgccagctt tagagtatct       300
     gatggacaaa atctagaatt tgatgacgaa agctttgacc ttataattag caggaacgtt       360
     gcctggactc taattgacgc tgaaaaagca tacagtgaat ggaaaagagt tttaaaaacc       420
     gacggtaaaa tcattatgtt tgatgctaat tggaatataa gattattcaa tgaagcatac       480
     atggaaaaat atatggaaga ccaaaaggaa tacgtaagat tgtttggcga agagcctccc       540
     cagtacactg ctgaaatgat cgattttaga aaaagtatgc ccatgtgcca gagaataaga       600
     ccgcaatggg atttcaacaa gcttttggaa cttggatata aaaagattta ctgtgaaact       660
     gacataggag acagggttta taacgaaaag gaaagggtca taaatcgttc taccccaatg       720
     tttatgcttg ttgtagaaaa gtag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page