(data stored in ACNUC7421 zone)

EMBL: CP001720.PE499

CP001720.PE499       Location/Qualifiers
FT   CDS_pept        557666..559429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0544"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   sat:SYN_01564 phospholipid-lipopolysaccharide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61464"
FT                   /db_xref="GOA:C8W609"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W609"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61464.1"
FT                   /translation="MLYKLWKLARPSPVLLLLTGFLIILSAVSGLASPWIIRYAVDNLI
FT                   LTGRVHLLWMAAMAIIVFSLLQTGCTFAARYLAEYMGQSSLLDLRNKLYRHLNQLSFSF
FT                   YDSARTGDIMSRLTVDTNILNNFFGFAAINIVTNSLTILGIIIVLFYWNWQLGLAFLLI
FT                   TPAVVHGINTHAGKVQPAFSRLHRQLGKMTNILEESLTGIGLVKLTGSEAYELEKFEQQ
FT                   NREYLLTTMSVLKISSLWQPYVQFLTTLGIAVAMWSGGRAVIEGSITTGVLIGFITYMG
FT                   MLVRPIRQTGRMVNVVARSLAAGQRIFEVLNWEPDIKDAPDAYPLPPVKGHVCYENVSF
FT                   SYDGKNQILEEINLTVEPGQMVALVGPTGAGKTTLIHLIDRFYDPVGGSIKIDGHDLKR
FT                   VTLESLRRQLGIVLQDTFIFNTTIRENIAYGKPSATNDEVERAARLAQIHDFIISLPMG
FT                   YDTAVGTRGMTLSGGERQRIAFARVLLTNPRLLILDEATSELDAQTEAALHKAIHEVIK
FT                   NRTVIIIAHRLWTIQNADKILVLSGGRIVESGSHQELLRLDGNYSRFYDLFLQNKKLPD
FT                   NFDFGGGSQAK"
     gtgttataca aactatggaa gttagcccga ccttcgcccg tactgctttt actgacagga        60
     tttctgatta tcctgtcagc agtttcaggc ctggcctcgc cttggataat acgttatgct       120
     gtggacaatc tgattctaac tggtagagtt catttattgt ggatggcggc aatggcgata       180
     attgtttttt ctttattgca gaccggttgt acttttgctg cccgttacct ggctgaatac       240
     atgggccaga gttctttatt ggacttacgc aacaaactgt accgtcattt gaatcaatta       300
     tctttttcct tttacgacag tgcccgtacc ggtgatatta tgtcccggct tactgtggat       360
     acaaatattc tgaataactt ttttggtttt gcagctatta atattgtaac caatagcctg       420
     accattttag gcattattat agtcttattc tattggaact ggcagctggg actggccttt       480
     ttattgataa caccggctgt agtgcacggt atcaatactc acgccggaaa agtgcagcct       540
     gctttttccc ggcttcaccg gcagttaggg aaaatgacaa atatactgga agaaagttta       600
     acagggatag gcctggttaa gttaaccggc agcgaagcat atgaattaga aaaatttgag       660
     cagcaaaaca gagaatattt gttaaccact atgagtgtct taaaaatatc ttccttgtgg       720
     cagccttacg tgcaatttct aactaccttg ggcattgctg ttgccatgtg gagcggtgga       780
     cgggcagtca tagaaggaag tattacaacc ggtgtattaa taggttttat aacttatatg       840
     gggatgctgg ttaggcctat ccggcagacg ggaagaatgg ttaatgtggt ggcccgctcg       900
     ctggctgcgg gccagcgaat ttttgaggtt ttgaactggg aaccagacat aaaggatgcg       960
     cctgatgctt acccgctgcc tccggtaaag ggccatgttt gttatgaaaa tgttagtttt      1020
     tcctacgatg gcaagaacca aatacttgag gagataaacc ttacggttga gccgggtcag      1080
     atggttgccc tggtagggcc gaccggtgca gggaaaacca cccttattca tcttatagac      1140
     aggttttacg atccggttgg gggcagcatt aaaattgacg gtcacgattt aaaaagagtt      1200
     acgctggaaa gtttacgccg gcaattaggt atcgtgcttc aagatacttt tatctttaat      1260
     actaccatac gggaaaatat tgcctatggc aagccttctg ccactaatga tgaagttgaa      1320
     cgtgccgcca ggttggccca gattcatgac tttattattt cattgcccat gggttacgat      1380
     actgcggtag gcactcgtgg aatgacactt tccggcggtg aaagacagcg tatagcattt      1440
     gccagggttt tgcttaccaa tccccggctt ctcatcttag atgaagcaac ctccgagctg      1500
     gacgcacaaa cagaagcagc tttacataaa gcaatccatg aagtaattaa gaacagaacg      1560
     gttattatca ttgctcaccg tctttggacg atacaaaacg cggataaaat tctggtgctt      1620
     tccggaggaa ggatagttga atcaggcagc catcaagaac ttctacgctt ggatggtaat      1680
     tacagtaggt tctatgattt gtttttgcag aacaaaaagc ttcctgataa ctttgatttt      1740
     ggaggaggga gtcaggcaaa gtga                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page