(data stored in ACNUC7421 zone)

EMBL: CP001720.PE501

CP001720.PE501       Location/Qualifiers
FT   CDS_pept        complement(561398..563647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0546"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   prw:PsycPRwf_1367 putative outer membrane adhesin like
FT                   proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61466"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W611"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61466.1"
FT                   /translation="MRYKVLILFAFYMLFSLSIGNQSAFASTVNKVLNVPTIKSATTTS
FT                   LGTLMIKEEYPMTLKKGDILCVNLPSYIAMKQVHIDFFYDYDVTTVNSAVYSLSANDFK
FT                   NMTCFSDNDNILSMQVENEQNFTLKINKIPENSTAKTFRFYIYFDSVTCKIKATDGDET
FT                   KVILDGSGGFSSDTQTIAKVYAYGNGTTASAISSETLTDLGGETGTIVIKENGPGALEI
FT                   NTDTSDPDNCKEQKTVKLVLSAGVSWTSANIIATGGFTNSDIGYLIDVDSSGRSVLYLQ
FT                   INNKTTDATGSGRITLTGEVDVDSSIAQPGEIYAYYEGSNPGVSTATLTVATFKMPGCK
FT                   VGNSTPTEVIAGHKDQAIGDIIIMQGLTGDLTSGRTVTFTLPEGVKWRSYPTNNAKMLD
FT                   QATPVGSDGRTIKYTVPFPQPGSSSCILRNGSVDLAFDAPSQIEITVGGSVFSTEGKTI
FT                   VANVITPIKLTASETDIFVGKQKQAVGDLIINETVAGTLRALDRNQSRAVLEIMLPPGV
FT                   TFNKDNPPVVKVTDGDLVLFTDQVGLDSENQRTLLIPVSKSSSVSSTIEISNVILDVNR
FT                   MVPEGSVKVEVGGTALTETDDLFNGSQNFLKAVIANCPTAAPQEIKTKAIFTIDSNSYE
FT                   FNDKKYDMDVAPYIKNDRTYGPVRYIAYALGLNEQDVQWDASSQTVTLMHGGRVVQMKA
FT                   GQPTMLVQGTEISIDAEPEIIEPGRLMLPYRWAASALNGNITWDADKKQVTVQNY"
     ttgagatata aggttttgat tctatttgcc ttttacatgc tttttagctt gtcgatagga        60
     aaccaatccg cattcgccag tacggttaat aaagtattaa atgtaccaac tattaaatcg       120
     gccactacaa caagcttggg caccctgatg attaaggaag aatatcccat gacattaaaa       180
     aaaggtgata ttttatgtgt taatttaccc agttatatag caatgaaaca agtccacata       240
     gattttttct atgattacga tgtcacaact gttaattctg ctgtttacag tttaagtgca       300
     aacgatttta agaatatgac ttgttttagt gacaatgata acatactcag tatgcaggta       360
     gaaaatgaac agaactttac tttgaaaata aacaaaatcc ctgaaaattc taccgctaaa       420
     acttttcgct tctatattta ctttgacagc gtgacatgca agataaaagc aactgatggt       480
     gatgagacaa aagttattct ggacggaagc ggcggtttta gttccgatac tcaaacaatt       540
     gctaaagtat atgcttacgg aaacggcact accgcaagcg ctatttcttc agagactctc       600
     accgatctgg gaggagaaac cggcaccatt gtaattaaag agaacggacc tggtgctctg       660
     gagataaaca ctgacacatc tgatccggat aactgcaaag aacaaaaaac agtaaagctg       720
     gttttatctg ccggagtaag ttggacaagc gctaatatta tagcgacagg tggttttaca       780
     aattcagata tcggttacct gatagatgtg gatagcagcg gtcgcagtgt tttgtacttg       840
     caaattaata acaaaacaac agatgcgacc ggatcgggac gtataacgtt aacaggagag       900
     gtggacgtag acagcagtat agcccagccg ggggaaatat atgcatatta cgaaggaagt       960
     aatcccggag ttagcactgc tactctgact gttgcaactt ttaaaatgcc gggctgtaaa      1020
     gtcggcaact ctactcctac ggaggtaatt gcgggccaca aagatcaggc tatcggtgac      1080
     attattatca tgcaaggctt aaccggtgat ctgacttcgg gacgcacagt aacttttact      1140
     ctaccggaag gtgtaaagtg gcgcagttac ccgacaaaca acgctaagat gctggatcag      1200
     gccacaccgg taggcagtga tggacgtaca atcaaatata ctgttccttt tccccaaccg      1260
     ggcagcagca gttgtatctt aagaaacggc agtgttgatc tggcctttga tgctccttct      1320
     caaatagaaa taaccgtagg tggttcagta ttttcaactg aaggcaaaac aatagtggct      1380
     aatgtaataa caccgattaa attaactgct tcagaaactg atatatttgt cggcaagcag      1440
     aaacaagcgg tgggagatct gattatcaat gaaaccgtgg caggaacctt gcgcgcactg      1500
     gacagaaatc agagtagagc ggtgttggaa attatgctgc cgcccggtgt aacatttaat      1560
     aaagacaatc cccctgtggt taaagtaacg gatggcgatt tagtattatt tacagatcag      1620
     gttggcttag attctgaaaa ccagagaact ttattaattc ctgtaagcaa atccagcagt      1680
     gtgtccagca caatagaaat tagtaatgtt attttggatg taaacagaat ggttccggaa      1740
     ggcagcgtaa aagtggaagt gggcggtact gctttaacag aaaccgacga tttgtttaac      1800
     ggctcacaaa attttttaaa ggcagttata gcgaattgtc ctaccgctgc gccccaggag      1860
     attaaaacca aagctatatt tactattgac agtaacagtt atgaatttaa tgataaaaaa      1920
     tatgacatgg atgttgcccc atatataaaa aatgatcgca catacggtcc ggtacgttat      1980
     atcgcctatg ctctgggact aaatgaacaa gatgtgcagt gggatgcttc atctcaaaca      2040
     gttacattaa tgcatggcgg acgggtagtg cagatgaaag ccggccagcc tactatgctt      2100
     gtgcagggca cggaaatttc cattgacgcg gaacctgaga taatagagcc gggccgttta      2160
     atgttgcctt accgctgggc agcatcagct ctaaatggca atattacttg ggatgcagat      2220
     aaaaaacagg taactgtgca gaactactag                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page