(data stored in ACNUC7421 zone)

EMBL: CP001720.PE510

CP001720.PE510       Location/Qualifiers
FT   CDS_pept        complement(569812..570765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0555"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: dps:DP0217
FT                   Fe(III) ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61475"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8W620"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV61475.1"
FT                   /translation="MNKQSKIISVFLVIFIITILAGCAQTKPASTPDNIMVVDDLGKEV
FT                   KLKEPAKRIISLYTGHTENLYSLGLNDEIIGVSDSESFPPSALKKQSFSYREDAEKLIA
FT                   AKPDLVLIRTFIANNYPDFVNKLETAGIPVAVLYPENVDQFLQYLKKLGKLTGKEKEAG
FT                   ELVDQFNSQLKKIGDVVAKIPQQERKKVFFETTKDITTCTPDSIAAFILEKAGAINVAI
FT                   DAKAVRPGSTIASYGQERLLAKARDIDVYLVQKGEMNKTREEEIYLRPGYQAIKAIQNH
FT                   QVFLVPEALVSRPTMRLLDGIAEIGRVLYPDYFKTV"
     atgaataagc aatccaaaat tatttctgtt tttctagtaa tcttcataat taccatactg        60
     gccggatgcg cccaaaccaa gcccgcgtca acacccgaca atattatggt ggtagacgat       120
     ttgggtaagg aagtaaagct aaaagaaccg gcgaagagaa ttatatcact ttacaccggg       180
     catacggaaa acctttattc tctggggcta aatgatgaaa ttattggggt ttccgacagc       240
     gagtccttcc cgccctctgc tctgaaaaaa cagtccttca gctaccggga agacgctgaa       300
     aagctcattg cagccaagcc ggacctggtg cttatcagaa cttttattgc caacaattat       360
     ccggattttg taaataaatt ggaaaccgcg ggtattcccg ttgcggtcct gtacccggag       420
     aatgttgatc aatttcttca gtacctgaaa aaactaggca aactaacagg aaaggaaaaa       480
     gaagccggcg aactggtaga tcaatttaac agccaattaa agaaaattgg ggacgtggtg       540
     gccaaaatac cccagcaaga gcgaaagaaa gtgttctttg agacaactaa ggacataaca       600
     acctgcactc cggactcaat cgccgctttt attttggaaa aggccggggc cattaatgtg       660
     gcgattgatg ctaaagcggt gagaccgggc agcaccattg cctcatatgg tcaggaaagg       720
     cttctggcca aagctaggga cattgatgta taccttgtgc aaaaaggtga aatgaacaag       780
     accagagaag aagaaatata tctgcgaccc ggttaccagg ccatcaaggc aatacaaaac       840
     caccaggttt tcttggtgcc agaggcactg gtatcacgtc ccaccatgcg gttattggat       900
     ggtatcgcag aaattgggcg agttttatat ccggattact ttaagactgt ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page