(data stored in ACNUC7421 zone)

EMBL: CP001720.PE513

CP001720.PE513       Location/Qualifiers
FT   CDS_pept        complement(572752..573699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0558"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG: plu:plu2989
FT                   cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61478"
FT                   /db_xref="GOA:C8W623"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W623"
FT                   /inference="protein motif:PRIAM:4.99.1.3"
FT                   /protein_id="ACV61478.1"
FT                   /translation="MKRAISLSSVILVLFLLMGCSNTGKQNPTAQNTNPETEKKAILIV
FT                   SFGTTYEDTRKLTIEAVENRAKEEFKGWDVRRAFSSHTIIKVLKERDGIEVDTPEQALQ
FT                   KLKNDGYTTVVVQMLNIIPGVEYDYIKKVVDQYKNDNSFKKISCGLPLLYYMGQENEPN
FT                   DFITALEALKTQLPSSMKNDEALLVLAHGTPHPANAYYTVLQHTINELGFKNTYVYTVE
FT                   GTPTLEEVIPQLKANNIKKITLIPFMLVAGDHANNDMAGEEKDSHTSQLKAEGFAVDSY
FT                   LHGLGENKEIQNIYMNRIKQAMNELNSKPAGEEK"
     atgaaacggg ccattagttt gagcagcgta atacttgtat tatttttact gatggggtgc        60
     agcaatacag gcaaacaaaa tcctaccgca caaaacacta acccggaaac cgagaaaaaa       120
     gccattttga tcgttagctt cggaaccact tatgaagata cccgcaagct tacaattgaa       180
     gcggtggaga acagagctaa agaagaattt aaaggctggg atgttagacg agctttcagt       240
     tcccatacga ttattaaagt cttgaaagaa cgcgatggaa ttgaggtaga tacaccggag       300
     caagccttac aaaaattaaa aaatgacggc tatactactg ttgtggtgca aatgttgaat       360
     ataattccag gcgtggaata cgattacatt aaaaaagtgg tagaccaata caaaaacgac       420
     aattctttta aaaagatctc gtgcggtctt cccctcttgt actatatggg acaagaaaac       480
     gagccaaatg attttatcac tgcactggaa gcactaaaaa cacaattacc gtcttcaatg       540
     aaaaacgatg aagcgcttct cgtgctggca cacggaacgc ctcatccggc caatgcctat       600
     tatacagtac tgcagcacac aataaacgag ctgggcttta aaaacaccta tgtatatacg       660
     gtggaaggaa cgccgacgct ggaggaagta attccgcaat taaaagctaa taatatcaaa       720
     aaaattactt tgattccgtt tatgcttgta gccggcgacc atgccaataa cgacatggca       780
     ggtgaagaga aagattcgca tacgagccag ctgaaagccg aaggttttgc agtggatagc       840
     tatcttcacg gtcttggcga aaataaggag attcaaaaca tttacatgaa tcgtataaaa       900
     caagcgatga atgaacttaa ttcaaagcct gccggtgaag aaaaatag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page