(data stored in ACNUC7421 zone)

EMBL: CP001720.PE514

CP001720.PE514       Location/Qualifiers
FT   CDS_pept        574935..578441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0559"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61479"
FT                   /db_xref="GOA:C8W624"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W624"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61479.1"
FT                   /translation="MRRKNTKLQFITLSVMIFFILNIIQFSGLTSQSANGQEAVYTSAE
FT                   MAAKAVDFINDKYKAGEKIDGYTAYVLAMAGQDLSSEKWSINGTSLRSEIENLADLMGN
FT                   NVNLINYVCLTQNNDGSFGPYANEYGTKVPLQALSTVKEDITVGSDVYNQVQSAIDNAV
FT                   NFFKTKYQNGGMTYDVNGWSFDYRCVEALAKSGEDLSVGGWVYNGVSLKDSIMLSANST
FT                   ARSIKKDSSVQDAVYLSKELTALYAVDKASTDIDVLAGAITAKQNGDGSFGTNMFDHIM
FT                   VLNALGKAGAISNIDQTKAFNFIDNLKEIHKNSWGQDAGVAWGSQYTSGFEESDTTAQV
FT                   ITALSYFSEAKNEGSDVYKTIQGGLTYLNDVQDADTAAIVRIEGDSTFSSAETLLALKS
FT                   LGYTFDQYTGTASKWVKNSRTKTITQCIKAVNKWGDAGRLDRLIRLLADRQKAEDPGKG
FT                   SFENSVYSDMWAYLALGEAGKLDGLNTGDAKTYILSKQDTSGSWGEIFDQYYPDFLSTA
FT                   QAIRSLSYLPEAGEADVQAAINKGLNYLKTLQRDDGSVSAKDDDPAVDNSELIITLNRL
FT                   NIDPQGAEWTKTVDGKKFTPVSYLMNNTMNADGSFGASKNVFGATEALYAYLIQDGTGN
FT                   PGGDGPGGGSSENRCSVNIAIVGKDDEIIYRPGSVILDKTSKWGITAMGALHATGLSYV
FT                   GDSSFVKSIDGLANSGMNGWMYSVNGVVPMTTASDKVVKEGDRVIWWYSTDMNSSGPSW
FT                   DSLLKGSAGAGGNQSAAASSTSLIEQNKELPDALQVSEKALAALEQIALLLNPQDIEKE
FT                   NTLDASVQDDEINNVIVVGSRQPLNLALLKTLKKELDQNEVQLTQKVEADSGAVLLDAK
FT                   EELALVIPAKSLNKDMEINVKEAAAGNQQETAAPSGFRQVSAIYDFGPKDTVFTMPATL
FT                   TFKLVMPPLVKPDRLVLAYYDKVAGKWVSVPAVVDLDKGLVLTKLRHLGQYAVFARESL
FT                   KTFADVNETSSSWAKDYIENLAGAGIVDGIDATHFEPSRKVTRAELTSLLVKALGISTD
FT                   QSSAISLKDVQADDWYAGAVGAAQAAGLITGYEDGTFRPGNTVSREELAVILVRAMKLE
FT                   SDQEKMWFADIDKINSWARDSVFTASSKGLIKGFPDGTFRPDVAAGRDECAVIIFRMLN
FT                   EY"
     atgaggagaa aaaacacaaa attacaattc ataacgttat cagtaatgat attttttatc        60
     ctgaacatta ttcagttttc cggattaacc agccagtcag caaacgggca agaggctgta       120
     tatacttctg ctgaaatggc ggcaaaagca gttgatttta ttaacgataa gtataaggcg       180
     ggagagaaaa ttgatggcta taccgcttat gtgctggcta tggccgggca ggatttgtca       240
     agtgagaaat ggagcataaa cggcactagt ttaagaagtg aaatcgaaaa cttagccgac       300
     ttaatgggaa ataatgttaa tttaataaat tatgtttgct taacccagaa taatgacggc       360
     agtttcggcc cttatgccaa tgaatatggg acaaaggtgc cgctgcaggc tttgtcgaca       420
     gttaaagaag acattactgt cggcagcgat gtttacaatc aggtgcagag tgccattgat       480
     aatgctgtaa acttttttaa gacaaaatat caaaacggcg gcatgaccta tgatgtaaac       540
     ggttggagtt tcgattaccg ctgtgttgag gcactggcaa aatcggggga ggacctgtca       600
     gtgggcggtt gggtctataa tggtgtatcc ctcaaagaca gcataatgct ttctgccaat       660
     agtacggcgc ggtccattaa aaaggattca tctgtacagg acgctgtgta tctgtccaaa       720
     gaacttacgg ctctttatgc tgttgacaaa gcttcaaccg acattgatgt tctggccggt       780
     gcgattacag ccaaacaaaa tggtgacggc agtttcggga caaatatgtt tgaccatatt       840
     atggttctga atgctctcgg aaaagctgga gcaatcagta atattgacca gacaaaggca       900
     tttaatttta ttgataattt gaaagaaatt cataagaact cctggggtca agacgccggt       960
     gtagcctggg gctcacagta cacaagcggt tttgaagagt ctgataccac tgcccaggtt      1020
     attacggcac tcagttattt ttctgaggcg aagaacgaag gcagcgatgt ttataagact      1080
     atacagggtg gtcttaccta tcttaacgac gtgcaagatg ctgacacggc ggccatagtc      1140
     cgtatagaag gtgacagcac cttttcctct gctgaaacac tgctggcact caagtcactg      1200
     ggatatactt ttgaccagta tacagggact gcttcaaaat gggtgaaaaa ttcccggacg      1260
     aaaactataa ctcagtgcat aaaggcagtg aacaaatggg gtgacgccgg acgcctggac      1320
     aggctgatta gacttttggc agaccggcaa aaagcagagg atccgggtaa aggttctttt      1380
     gaaaacagcg tatacagcga tatgtgggct tatttagccc ttggtgaagc cggaaagctt      1440
     gacgggctta acaccggcga tgctaaaacg tatattttat ctaagcagga tacttccggt      1500
     tcctggggag aaatctttga tcaatactac cctgatttcc tttccacagc acaggctatc      1560
     cggtcgctca gctatctgcc ggaagccggt gaggcagatg ttcaggcagc aataaataaa      1620
     ggtctgaatt atctgaaaac ccttcagcgg gatgacggca gcgttagcgc aaaagatgat      1680
     gaccctgctg tagataattc tgagctaatc ataactttaa atagattgaa tatagatcca      1740
     caaggtgctg aatggacaaa aactgttgat ggcaaaaaat ttactccggt atcttatctg      1800
     atgaataaca caatgaatgc cgatggcagc tttggcgcat ctaaaaatgt ttttggagcc      1860
     actgaagcac tttatgcata tttaattcag gacggtaccg gtaaccctgg cggagacggt      1920
     ccaggaggcg gctcgtctga gaaccggtgc agtgttaata tcgcgatagt gggaaaggac      1980
     gacgaaatta tttacagacc gggcagtgtt atcctggata aaacttcaaa atggggtatt      2040
     actgctatgg gcgcactcca tgccacaggt ttgagctatg taggcgacag cagttttgtt      2100
     aagagcattg atgggctggc taacagcggc atgaacgggt ggatgtacag tgttaacggg      2160
     gttgtgccta tgactactgc ttctgataaa gtggttaaag agggggatag ggtaatctgg      2220
     tggtatagta cggatatgaa ttcatcagga cctagttggg acagtctctt aaaaggatct      2280
     gcaggtgccg ggggcaatca gtcggcagct gcttcatcaa ctagcctcat tgagcaaaat      2340
     aaagaacttc cagatgcatt gcaggtttcg gaaaaggctc tggcagcgct ggagcagata      2400
     gccctgctgc ttaatcctca agacattgaa aaagaaaata cattggatgc atcggttcag      2460
     gacgacgaga ttaataatgt aattgtagta ggcagcaggc agcctttaaa tctggctttg      2520
     ctcaaaacat taaaaaagga actggatcag aatgaggtac agttaacaca aaaagttgaa      2580
     gcggacagtg gagctgtcct gttggatgcc aaagaggaac tggctctggt tattccggct      2640
     aagtcactta ataaggatat ggaaataaac gttaaggaag cagctgccgg caatcagcag      2700
     gaaactgccg caccgtcagg ttttcgtcag gtgtcagcaa tttacgattt tggtcccaaa      2760
     gatactgttt ttactatgcc ggcgacatta acctttaagc tggttatgcc tcctttggtt      2820
     aagccggata gactggtttt ggcctattac gataaagttg ccggcaagtg ggtatctgtc      2880
     cctgctgttg tggatttgga taaaggttta gtcctgacca agctgcggca tttaggacaa      2940
     tatgcggttt ttgcccgcga gtctttgaag acctttgctg atgtaaacga aacttcttct      3000
     agttgggcta aagattatat agaaaatctg gccggggccg gaattgttga cggtatagat      3060
     gctacacact ttgaaccgtc aagaaaggtg accagggcag aattgaccag tttattggtt      3120
     aaagccttag gcatatccac agatcaaagc tctgctatct ctctgaagga tgttcaagcc      3180
     gatgattggt acgcgggggc ggttggggca gctcaggcag ccggtttgat taccggctat      3240
     gaagacggca ctttccggcc gggcaacact gttagccgtg aagaactggc ggtaattctg      3300
     gtgcgcgcaa tgaaacttga gtctgaccag gaaaaaatgt ggtttgccga catagataag      3360
     attaactcct gggccagaga cagtgtgttc acagcttcat caaaaggtct cataaaaggt      3420
     tttcctgatg gaacttttcg tcctgatgtt gctgccggcc gggatgagtg tgcggttata      3480
     atctttagga tgttgaatga atattaa                                          3507
//

If you have problems or comments...

PBIL Back to PBIL home page