(data stored in ACNUC7421 zone)

EMBL: CP001720.PE515

CP001720.PE515       Location/Qualifiers
FT   CDS_pept        578538..579269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3366 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61480"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W625"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61480.1"
FT                   /translation="MGILKKKIIYITLTLVILAAILGPSIYANKFSRNQIAAQFKNNTT
FT                   TQTGESKSLPASDASKAGEQKTEAKQEAELKTGDAMPFQESEATDKDIKTKPVDKNNNS
FT                   GLSENKDSAGQLNKNAAAPDSSQEISRTVGMAVVGKEGELLYAPGSVTVTSKNIWDTTA
FT                   LGALDATSLPYKVSSGFSGFVEEIAGCRNKGQSGWMYMVNGEVPGVSASQKQVKTGDKV
FT                   IWWYSKSMDAPMPDWDALLKK"
     gtggggattc tgaaaaagaa aataatctat attacactaa cactggtgat tttagcagct        60
     attctgggcc cgtctattta tgcaaataaa ttcagcagaa accagattgc tgcacaattc       120
     aaaaataaca caaccaccca gacgggtgaa agcaagtcgc tgccggctag cgatgcgtca       180
     aaagccggag agcaaaaaac agaggcaaaa caagaagcgg agctaaaaac aggtgatgct       240
     atgccgtttc aagaaagcga agcaacggac aaagatatta aaacaaagcc tgttgataaa       300
     aataacaatt cagggcttag cgaaaataaa gatagcgccg gacagttaaa taaaaatgct       360
     gcggcgccgg acagttcaca ggagatttcc cgcactgttg gcatggctgt agttggcaag       420
     gagggggaat tgctctatgc gcctggcagc gttaccgtaa cctccaaaaa tatatgggac       480
     accacggcgt tgggtgcttt ggacgctacc tccctgcctt ataaagtgtc cagcgggttc       540
     tcaggttttg ttgaggaaat tgccggttgc cgtaataaag gacagtcagg ctggatgtat       600
     atggttaacg gtgaagttcc gggagtttcc gccagccaaa aacaggtgaa aacgggagat       660
     aaagttatct ggtggtacag taagagtatg gatgctccaa tgcccgattg ggatgctttg       720
     ttaaaaaaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page