(data stored in ACNUC7421 zone)

EMBL: CP001720.PE517

CP001720.PE517       Location/Qualifiers
FT   CDS_pept        580711..581640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0562"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bar:GBAA3365
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61482"
FT                   /db_xref="GOA:C8W627"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W627"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV61482.1"
FT                   /translation="MREKLFYQEKGLFIQSLHPFTSVVYLGTLLFLSLAFNNPLYLLGI
FT                   LIMIVLAIWAADGWKTWETYMIISLPMILLIIVINPLINSAGKTVLWYGPHIPFWGRLN
FT                   ISLEAICYGAAMSVRLLDIISLFCLYNIIVHPDKVLNLFSRFAGKSTLVISLSTRLFPS
FT                   MFRELENVKDVQRLRGVDFRQGTIKERIKKHFSLINILLLSSLENSLGIAESMQARAFG
FT                   SGPRSVYSAHMLRPRDILCLSGSSLALGISIWGLLRGFGMYNFYPQLDFLINDPVTVVV
FT                   LAAVMLSLSVPVLLSWGWQYCRFMKSKI"
     gtgcgggaaa aattgtttta tcaggaaaaa ggcctcttca tacaaagcct gcacccgttt        60
     acatctgtag tttatctggg tacgctgcta ttcctgtcct tagcctttaa caacccgctt       120
     tatttactcg gaatattaat aatgattgtt ttagcgatat gggcggcgga tggttggaag       180
     acctgggaaa catatatgat aataagtttg cccatgatat tgttgattat tgtcataaac       240
     cccttaatta acagcgccgg aaaaactgtt ttatggtatg gtcctcatat tccgttttgg       300
     ggccgcctta atatttcttt ggaagctata tgctacggag ctgctatgag cgtcaggctt       360
     ttggatatta tcagtttgtt ttgcctgtat aatataatcg ttcacccgga taaagtcttg       420
     aacctgtttt ccagatttgc aggtaaatcc acgctggtaa tatccttgtc taccaggctg       480
     tttccgagca tgttcaggga actggagaat gttaaagatg tccagcggct gcgaggtgtt       540
     gacttcagac aagggacaat caaggagaga attaagaaac atttttcttt gattaatata       600
     ttgcttttgt cttctctgga aaactcactg ggcatagcag aatctatgca ggctcgcgcc       660
     tttggcagcg ggcctcgctc cgtttactcc gcacatatgc tgagaccgag agatatactg       720
     tgcctgagcg gcagttctct ggcactggga ataagtatct ggggattgct gcgcggtttt       780
     ggtatgtata atttttaccc gcagctggat tttttaatca atgatccggt aactgtagtt       840
     gtgttggctg ctgttatgtt aagtttatcc gttccggtat tgttgagttg ggggtggcag       900
     tattgccggt ttatgaaatc aaagatctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page