(data stored in ACNUC7421 zone)

EMBL: CP001720.PE52

CP001720.PE52        Location/Qualifiers
FT   CDS_pept        59444..61054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0054"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61017"
FT                   /db_xref="GOA:C8VVE8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE8"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACV61017.1"
FT                   /translation="MAKFIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKLDPYIN
FT                   IDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSRSSNVTTGGIYWSVITKERR
FT                   GDYLGGTVQVIPHITNEIKERVLRVAEEKNPDVVITEIGGTVGDIESLPFMEAIRQLKG
FT                   DLGRGNVMYIHVTLVPYLKVANELKTKPTQHSVKELRGIGIQPDVIVCRTEEPISKDME
FT                   EKLALFCDIDKEAVIQAVDARSIYEVPLMLEREGLADIAVERLRLECSPPDLTEWQDMV
FT                   LRMSHLRQETNIALVGKYVSLPDAYLSVAEALRHAGLYHGSAVNIKWINAEDLERVPAE
FT                   EYLRDADGILVPGGFGDRGIEGKIFAIKYARENLIPMLGICLGMQLAVVEYARNMMGWR
FT                   LANSTEFNPQTPYPVIDLLPTQKNIEDMGGTMRLGRYPCKLLPNTKAYLSYKQEIIYER
FT                   HRHRYELNNTFRAGLAEKGLIMSGTLPNGQLVEIVELPEHPWFVATQFHPEFKSRPNRP
FT                   HPLFRDFIGAALERGKNKI"
     atggccaagt ttatctttgt caccggtggg gttgtctctt ctttagggaa aggaattact        60
     gccgcttcac tgggccggct tttaaaaaac cggggcttaa atgttaccat tcaaaagctc       120
     gatccttata taaacattga tcctggtact atgagtcctt accagcatgg tgaagttttc       180
     gttaccgatg atggtgcgga gacagattta gaccttggtc attacgagcg ttttattgat       240
     ataaatttaa gcagaagcag taatgtaact actggcggta tatattggtc ggttataacc       300
     aaagagagaa ggggagatta cctgggcggt actgtgcagg ttattcctca tatcactaat       360
     gaaattaaag aaagagtttt gcgagtagct gaagaaaaaa atcctgatgt tgttattact       420
     gaaatagggg gcacagtagg ggatattgaa tcactgccct ttatggaggc tatcaggcag       480
     cttaaaggcg acctgggcag aggaaatgtt atgtacattc atgtaactct ggttccctat       540
     ttaaaggtag ccaatgaact gaaaactaag ccaacccagc acagtgtgaa agaacttcgt       600
     ggcataggga ttcagccgga tgtcattgtt tgtcgcactg aggagcctat atctaaagat       660
     atggaagaaa aactggctct tttttgtgat atagataaag aagccgttat tcaggcggtg       720
     gatgccaggt caatttatga ggttccttta atgctggagc gtgagggtct ggcagacatt       780
     gcggtggagc gattgaggct tgaatgcagc ccacccgatt tgactgagtg gcaggacatg       840
     gttttgcgta tgagccacct gcgccaggag actaatattg ctttagtagg taaatatgtt       900
     tctttgccgg atgcttatct aagtgtggct gaggcgttgc gacacgctgg tttgtatcat       960
     ggttcggcag taaacattaa atggataaat gcagaggatt tggagagagt accggctgaa      1020
     gaatacctga gggacgctga tggcatactt gtgcctggtg gttttggtga caggggtata      1080
     gaaggcaaga tttttgctat taagtatgcc agagaaaacc tgatacctat gttgggtatt      1140
     tgtttgggta tgcagcttgc cgtggttgaa tacgcgagga acatgatggg ctggcgttta      1200
     gccaatagca ctgaatttaa ccctcagact ccctatccgg ttattgattt gctgcccaca      1260
     caaaaaaata tagaggatat gggcggtaca atgagattag gccgctatcc ttgtaagctt      1320
     ttgcctaata ctaaggctta cctttcttat aaacaggaaa tcatatatga aagacatcgc      1380
     catcgctatg agttgaataa tacttttcgt gcgggcttgg ccgaaaaagg attgattatg      1440
     agcggtactt tgccgaatgg tcaattagtg gaaatagttg agctgcctga acacccctgg      1500
     tttgtagcta cacagtttca cccggaattc aagtcaagac cgaaccgccc tcacccgtta      1560
     ttcagggatt ttattggcgc tgcactggag agagggaaaa acaaaatata a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page