(data stored in ACNUC7421 zone)

EMBL: CP001720.PE521

CP001720.PE521       Location/Qualifiers
FT   CDS_pept        585120..586160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0566"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: dps:DP1325 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61486"
FT                   /db_xref="GOA:C8W631"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W631"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACV61486.1"
FT                   /translation="MIKAAIIGATGYAGAELVRILSRHPQVRLTAITSQSYAGQAFWQV
FT                   YPHLYKYIDLTCEEMDLINIINQSDVIFAALPHGHAMPIVLEAVKQNKKIIDLGADFRI
FT                   DDPVVYESWYKVTHTAVDLLAEAVYGLPEINRNRIKEARILANPGCYPTSAILGLAPLL
FT                   ARGLIEPESIIIDSKSGVSGAGRSLSLNTHYSEVNESIKAYNIGQHRHTPEIEQEISKI
FT                   AGQKITLSFTPHLTPMIRGILSTIYAKLKIEALDMDLGQLYRDFYQEEPFVRVLPEGCL
FT                   PRTKDVSGSNFCDVAVVKDKRTGRAVVVSAIDNLLKGASGQAVQNMNIMFGFAEATGID
FT                   DPSLYP"
     gtgattaaag cggcaattat aggagctacc ggctatgctg gggcggaact ggtgagaatt        60
     ttatcacggc acccgcaggt tcggttaaca gcaattactt cgcaaagtta cgccggtcag       120
     gccttttggc aggtttatcc acatttatat aaatatattg acttgacttg tgaagaaatg       180
     gatttaatta atattataaa tcagtcggat gttatctttg ctgcactgcc ccatggtcat       240
     gctatgccga tagtactgga agcggttaag caaaataaga aaattatcga cttgggagcg       300
     gattttcgta tagatgatcc cgttgtttat gaaagctggt ataaagttac acataccgcg       360
     gtggatttat tggcagaagc tgtatacggt ttgccggaga taaatcgcaa taggattaaa       420
     gaagccagaa ttctggctaa tcccggttgt tatcctacca gtgcgattct tggcttggcc       480
     cctttattag ccagaggttt gattgaaccg gagagtataa tcattgactc caaatcaggt       540
     gtttccggtg ctgggcgaag tttgtccttg aacactcatt actcggaagt aaacgaaagt       600
     atcaaggcct ataatattgg acagcacagg catactccgg agattgaaca ggagataagt       660
     aaaatcgccg gtcaaaaaat aacgcttagt tttacacctc atctaacacc gatgatcagg       720
     ggtattctta gtacgatata tgccaaatta aaaatagagg cactggatat ggatttaggg       780
     cagctttacc gtgattttta tcaggaggag ccttttgtgc gggtgctccc ggaaggttgc       840
     ttgccgagga caaaggatgt atcgggttct aacttctgtg atgttgctgt ggtaaaggat       900
     aagagaaccg gcagggcagt tgtagtatca gctatagata acctgcttaa gggtgcgtcg       960
     ggccaggcag ttcaaaatat gaacataatg tttggttttg ccgaagcaac aggaattgac      1020
     gatcccagcc tgtatcccta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page