(data stored in ACNUC7421 zone)

EMBL: CP001720.PE522

CP001720.PE522       Location/Qualifiers
FT   CDS_pept        586308..587525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0567"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: bha:BH2899 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61487"
FT                   /db_xref="GOA:C8W632"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C8W632"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ACV61487.1"
FT                   /translation="MSKEFKLELVPGGVTAASGFTACGVRAGIKNDKKDLAIIYSKLPC
FT                   SATGVYTTNKVQAAPVQLTRQRLSDGHAQAVIINSGYANACNGPQGLRDALKTSSVLAE
FT                   SLNIQENQVLVASTGVIGQNLPMDKILNGIALAVSQLSPEGGPDAAEAIMTTDTVSKQI
FT                   AVKFELSGVPVVIGGMAKGSGMIHPNMATMLGFITTDAAVDVHLLNKALKSVVEKTFNM
FT                   ITVDGDTSTNDMVLLLANGAAGNQQLDSEGSDFELFCCALCEVCISLSKEIAGDGEGAT
FT                   KLVEVKVINAATVNDARLAAKTVAASNLVKTAIFGADANWGRIICAAGYSGADFDPGKV
FT                   DIFLGNEQVAKDGKALDFSEENASEILSQKEVKILIDFKTGTETATAWGCDLTYDYIKI
FT                   NGSYRS"
     ttgtcaaaag aatttaagct ggaattagta cctggcggtg ttactgcagc ctccggtttt        60
     actgcttgtg gtgtgagggc gggtataaaa aacgataaaa aagatttagc aataatttat       120
     tcgaaactac cttgttcggc gactggtgtt tatacaacca ataaagttca ggcggctccg       180
     gttcagttaa ctaggcaaag actgtctgac ggccatgctc aggcagtaat tattaacagc       240
     ggttatgcca atgcctgcaa tgggccgcag ggtttgcgtg atgcattaaa aacctcttca       300
     gttttggccg aatctcttaa cattcaagaa aaccaggtgc tggtggcttc cacaggtgta       360
     ataggtcaga atttgcctat ggataaaata cttaacggca ttgccctggc tgtatctcag       420
     ctcagccctg agggggggcc ggacgcggcc gaagcgataa tgactacaga cacagtatcc       480
     aagcaaattg ctgtaaaatt tgaattgtcc ggtgtgccgg ttgtgatcgg cggtatggcc       540
     aagggttccg gaatgattca tcccaatatg gctaccatgc tgggctttat tactactgat       600
     gctgcggtag atgttcattt gttaaataaa gcattaaaat cagttgtaga aaaaactttt       660
     aatatgatca ctgtagatgg ggataccagc accaatgaca tggtgcttct tctggctaac       720
     ggggcggccg ggaatcagca actggacagt gagggttctg attttgagct gttttgctgt       780
     gctctttgcg aggtatgtat aagcctgtcc aaagaaattg ccggtgacgg tgagggtgcc       840
     accaagctgg tggaagtcaa agtaatcaat gctgcaaccg taaatgatgc caggctggcg       900
     gccaagactg tggcggcctc caatttagtt aaaaccgcta ttttcggagc agatgctaat       960
     tggggcagga tcatatgtgc ggcaggctat tcaggggctg attttgatcc gggaaaagta      1020
     gatatttttt taggcaatga gcaggtggca aaggacggaa aggcacttga ttttagcgaa      1080
     gagaatgctt ctgagatact ctctcaaaaa gaagttaaga ttttaataga ttttaaaacc      1140
     ggtacggaga cagcaaccgc ctggggctgc gatcttacct atgactatat aaaaataaac      1200
     ggcagttaca ggtcttaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page