(data stored in ACNUC7421 zone)

EMBL: CP001720.PE523

CP001720.PE523       Location/Qualifiers
FT   CDS_pept        587554..588441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0568"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: gur:Gura_0225 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61488"
FT                   /db_xref="GOA:C8W633"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C8W633"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACV61488.1"
FT                   /translation="MLTALEKAGILVEALPYIKKFYGKTVIIKYGGHAMINEQLKQAVL
FT                   TDAVLMKFVGMHPVIVHGGGPEITGMLKRVGKVSEFVGGLRVTDRETMEIVEMVLVGKI
FT                   NKDIVALINRFGGRAVGLCGKDAGLFKAVKKPGTLRLPDGSTQEVDIGFVGDISRVNPQ
FT                   IVVNLIGEGYIPVIAPVAVGDGGESYNVNADYAAGKLAEALKADKFINLTDVEGILRDR
FT                   NDLSSLISTLHVDEVPELIRQGIIDGGMIPKVECCIEAIKGGVPQAHILDGRVQHSILL
FT                   EVFTDQGVGTMVVS"
     ttgttgactg ctctggaaaa ggcgggcatt ttagttgaag cgctgcctta tatcaaaaag        60
     ttttatggaa aaacagtgat aatcaaatac ggcggtcatg ccatgattaa tgagcagctt       120
     aaacaggccg ttttaaccga tgccgtgctg atgaagtttg tgggcatgca cccggttatt       180
     gtacacgggg gtggcccgga aattaccggc atgttgaagc gggtgggaaa ggtttccgag       240
     tttgtcggcg gcctgcgggt aacggatcgg gagactatgg aaatagttga aatggtgttg       300
     gtcggtaaga taaataagga tattgtggca ctaatcaacc gttttggcgg tcgggctgtg       360
     ggactttgcg gcaaggatgc cggcttgttt aaagcggtca aaaaacctgg gacattgcgt       420
     ttgccggacg gctcgactca ggaagtcgat attggttttg tcggtgatat tagccgggta       480
     aatcctcaga tagttgtcaa tctaatcggt gaggggtata ttccggttat cgctcccgtt       540
     gctgtcgggg acggagggga aagctataac gtaaatgccg attatgctgc cggtaaatta       600
     gctgaggcct tgaaagctga taaatttatt aaccttactg atgtagaggg tatattgcgg       660
     gacagaaatg atctttcttc attaatatca accttgcacg tggatgaagt gccggaatta       720
     attagacagg gtattattga cggtgggatg attccaaaag tagaatgctg catagaagcc       780
     atcaaaggag gcgtgcctca ggcacatatt ctagacggca gggttcaaca ctctatactg       840
     cttgaagtgt ttaccgatca aggcgtcggt acgatggtgg tgagttga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page