(data stored in ACNUC7421 zone)

EMBL: CP001720.PE525

CP001720.PE525       Location/Qualifiers
FT   CDS_pept        589832..590794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0570"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: bsu:BSU11250 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61490"
FT                   /db_xref="GOA:C8W635"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C8W635"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACV61490.1"
FT                   /translation="MSSLLQLPISKDFKGRDFLLLLDFSAEEIKHLINVAVELKAIQKK
FT                   GEPHPYLQGKTLAMIFQKSSTRTRVSFEVAMYQLGGYPLFLSSNDLQMGRGETIADTAR
FT                   TLSRYVDGIMIRTYAQSDVEELAEYADIPVINGLTDLVHPTQVIADLQTVLEHKGKLAG
FT                   LKMAFLGDGNNVAHSLMAGCAKVGMNITLANPAGYKPLPEMVEKAKQVAETTGSIIEII
FT                   EDPVAAVKDADVIYTDVWASMGQEKEQEERAKMMAPYQVNAELVRHAKPDYIFLHCLPA
FT                   KREQEVTSEILDSNHSAAFDEAENRLHAHKAILALLMQK"
     atgtcctcac ttttacaatt acccatcagc aaggatttta aaggaagaga tttcttattg        60
     ctgcttgatt tcagtgcgga agaaattaag cacttaatta acgttgcggt agaattgaag       120
     gctatacaaa aaaaaggtga gcctcatcct tacctgcagg gtaaaacact ggccatgata       180
     ttccaaaaat cttctacccg taccagggtt tcttttgagg tggctatgta tcaattaggt       240
     ggctatccct tatttttaag cagcaacgac ctgcagatgg gacgtgggga aactattgcc       300
     gatacagcca gaactctttc ccgttatgta gacggcatca tgattcgtac ctatgcccag       360
     tcggatgtgg aggaactggc tgaatacgca gacataccgg taatcaacgg actgaccgat       420
     ctcgtgcatc ccacccaggt aatagcggat ttgcaaaccg ttctggagca caagggcaaa       480
     ctggccggct tgaaaatggc tttcctgggt gacggtaata atgtagccca ttcactaatg       540
     gccggttgtg ccaaagtcgg tatgaacatt acactggcca atcctgccgg ctataagcct       600
     ttgcccgaga tggtggaaaa agccaagcag gttgctgaaa caacaggcag tatcattgag       660
     ataattgagg acccggtggc cgccgtaaag gacgccgatg taatatacac tgatgtttgg       720
     gccagtatgg gccaggaaaa agagcaggag gaaagagcga aaatgatggc tccttaccag       780
     gtgaacgctg aactggtgcg tcatgccaag ccggattata ttttcctgca ttgcctgccg       840
     gctaaaagag agcaagaagt aacatcagaa atactggata gcaatcattc agcagccttt       900
     gatgaagcag aaaatcgttt gcacgcacat aaggctattc tggctctcct aatgcaaaaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page