(data stored in ACNUC7421 zone)

EMBL: CP001720.PE527

CP001720.PE527       Location/Qualifiers
FT   CDS_pept        592107..593477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0572"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pca:Pcar_2418 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61492"
FT                   /db_xref="GOA:C8W637"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C8W637"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACV61492.1"
FT                   /translation="MAKLWGGRFEKESDHLMEDFHSSISFDQRLYKQDIAGSMAHARML
FT                   GKAGIISKAEAERIVAGLQEILADIEAGKIEFSVAAEDIHMNIEELLTQRTGEVGKKLH
FT                   TARSRNDQVALDVRMYLKEEITEVMNLIKYLQDTLAELAEEHLDTVLPGYTHLQRAQPV
FT                   TLAHHLMAYYQMFSRDLDRLGDCYRRTDVMPLGSGALAGTTFALDRQYVAEQLGFARIS
FT                   ENSLDAVADRDFAVEFASAASLIMMHLSRFCEEIILWSTAEFAFIELDDAYSTGSSMMP
FT                   QKKNPDVAELIRGKTGRVYGDLQALLTMLKGLPLAYNKDMQEDKEALFDAVDTVKKCLM
FT                   LFRPMLATVKVKKENMARAARGGFTNATDLADYLVYKGVPFRQAHEIAGRLVLYCLAKK
FT                   KTLEEVSLGEYREFSDLIAEDIYQAIDINHCVEARKVYGGPARAVVQEAINRARGKF"
     atggccaagc tttggggtgg tcgttttgaa aaagaatcgg atcacttaat ggaggatttt        60
     cattcctcca tttcttttga tcagagattg tataaacagg atattgccgg cagtatggcc       120
     cacgccagga tgctgggcaa agcaggcatt atctctaaag cagaagcgga gcggatagta       180
     gcaggtttac aggaaatact ggcggatatc gaagcgggta aaatagagtt ttccgttgcc       240
     gcggaagata ttcatatgaa tatcgaagaa ctgttaactc aaagaaccgg agaagttggc       300
     aaaaaactgc ataccgctcg cagccgcaat gaccaggtgg cgctggacgt acgcatgtat       360
     ttaaaagaag agataacaga ggtcatgaat cttataaaat atctgcagga tacactggcg       420
     gagctggccg aagaacatct ggatacggta ctgcccggct atactcattt acagagggca       480
     caaccggtaa ccctggcaca tcacctgatg gcttattatc agatgtttag ccgtgatctg       540
     gacaggcttg gcgactgtta ccgccgcact gatgtaatgc ctttgggttc cggggctctg       600
     gccggcacca cgtttgccct ggaccggcag tatgtggccg aacagcttgg gtttgcccgt       660
     atcagtgaaa acagcctgga tgccgtggcg gatcgtgatt ttgccgtaga gtttgcttcg       720
     gccgcctctt tgattatgat gcacctgagc cggttttgtg aagaaataat tctctggtct       780
     acagcggaat ttgcgttcat tgaattggat gatgcttaca gtaccggcag cagcatgatg       840
     cctcaaaaga aaaacccgga tgtggcggaa ttaattcgtg gcaaaacagg tagagtttac       900
     ggcgatttgc aggctctttt gactatgctg aagggcttgc cgctggccta taacaaagat       960
     atgcaggagg ataaggaagc gctgtttgat gccgttgata cagtaaagaa atgcttaatg      1020
     ttgttccggc ccatgctggc cactgtaaag gtgaagaaag aaaatatggc aagagccgcc      1080
     cgtggtggct ttaccaacgc cactgattta gccgactatt tggtctataa gggggtacct      1140
     ttccgccagg ctcatgaaat agccggaaga cttgttttgt actgtttggc caagaaaaag      1200
     acactggagg aagttagcct cggggaatac agggaatttt ccgatttgat agccgaggat      1260
     atttaccagg ctattgatat aaatcattgt gtggaagcca gaaaggttta tggcgggccg      1320
     gccagggctg ttgtgcagga ggctataaac agagcaaggg gaaagtttta a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page