(data stored in ACNUC7421 zone)

EMBL: CP001720.PE528

CP001720.PE528       Location/Qualifiers
FT   CDS_pept        593656..594501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61493"
FT                   /db_xref="UniProtKB/TrEMBL:C8W638"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61493.1"
FT                   /translation="MNDLETEITRHNNDVIMKAMAETFKDKTLRLFGLNTEKIIGVIPT
FT                   VLPVLEVKENRTDYIFLLEDNTLLHLEFQTTVNLENLKRFLLYDARLINKDNRNVNTAV
FT                   VYSGRIEIAPEQLKLGSIVYQVINVYMKDYDGDAEYNRLHDKILKHEVLDEEDILKLIF
FT                   LPLMKSKHTEEEMAIRAAELAKEVEGEIKTFIIGAIIAVTDRFMSEDYKKKLLEVLRMT
FT                   QIERWIREEGREEGREEGKKEGKMETAKAALAKGFSIEDVIEITGLTKEVVRKLKNEMN
FT                   "
     gtgaatgatc tggaaacaga aatcacccgg cacaacaatg atgtgatcat gaaagcaatg        60
     gcagaaacct ttaaagataa aactcttcgt ctctttggct tgaatacaga aaaaattata       120
     ggcgtgatac ctaccgttct acccgtattg gaagttaaag agaatagaac agactatatc       180
     tttctgttag aagataacac tctactgcat ttggaatttc aaactaccgt taatttagaa       240
     aatctgaaac gatttttact ctatgatgcc agactaatca ataaagacaa tcggaatgtt       300
     aataccgctg ttgtttactc cgggcggata gaaatagctc ctgagcaact aaagctgggt       360
     tccatagttt accaggtaat caatgtttat atgaaagatt atgacggaga cgcggaatat       420
     aatagattgc atgataaaat actcaagcac gaggttttgg atgaggaaga tatattgaag       480
     ctgatctttt tgcccttgat gaagagcaag cataccgaag aggaaatggc tattcgcgcg       540
     gcagaactgg ctaaagaagt agagggtgaa atcaagacct ttataattgg tgcaattata       600
     gccgttaccg ataggtttat gtctgaagac tacaaaaaga aattactgga ggtgttgaga       660
     atgacccaaa tcgagcggtg gattagagaa gaaggtagag aagaaggtag agaagaaggt       720
     aaaaaggagg gtaaaatgga aacggccaaa gcagccctgg caaaaggctt cagtattgaa       780
     gatgttattg aaattaccgg gttgactaaa gaagtagttc gaaagctaaa aaacgagatg       840
     aattaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page