(data stored in ACNUC7421 zone)

EMBL: CP001720.PE532

CP001720.PE532       Location/Qualifiers
FT   CDS_pept        597298..597876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0577"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61497"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W642"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61497.1"
FT                   /translation="MISLAKGQKVDLTKTNPGLSKIIVGLGWDVNKYDGGHQFDLDSVA
FT                   FLLNSEGKATGEKDFIFYGNKQDAAGSVMHSGDNRTGDGEGDDETLAIDLSKIPSAIEK
FT                   IAVCINIHEAAERSQNFGQVSNAYVRVINEDNGEELLKFDLGEDYSIETGIVTCEIYRH
FT                   SGEWKFNAIGSGFQGGLAALCANYGLDAG"
     gtgatttctt tagcgaaagg acaaaaagtt gatttaacaa aaactaatcc cggtcttagc        60
     aagattattg tgggccttgg ttgggatgta aacaagtatg acggtggtca tcaattcgac       120
     ctggattcag ttgcttttct tttaaacagt gagggaaaag ctacaggtga aaaggatttt       180
     atcttctatg gcaataaaca ggatgctgcc ggttctgtta tgcacagcgg tgataacaga       240
     accggtgacg gtgagggcga tgatgagact cttgctattg atttgagcaa aatcccttct       300
     gctatcgaaa aaatagctgt ttgcattaat attcacgagg cggccgaaag aagccagaat       360
     tttggccagg tatccaatgc ttatgtgcgc gtgataaatg aagataatgg cgaggaactt       420
     ttgaaatttg acttgggtga ggattactcc attgaaacgg gtattgtaac ctgcgagatc       480
     taccgtcatt ccggagagtg gaaatttaat gccattggca gcggttttca gggaggactt       540
     gccgcattgt gcgccaacta cggcttggat gccggctaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page