(data stored in ACNUC7421 zone)

EMBL: CP001720.PE534

CP001720.PE534       Location/Qualifiers
FT   CDS_pept        598711..599889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_01791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61499"
FT                   /db_xref="GOA:C8W644"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W644"
FT                   /inference="similar to AA sequence:KEGG:ESA_01791"
FT                   /protein_id="ACV61499.1"
FT                   /translation="MSYFSCFSKEQKKKLFFIPPTERSLDNDKKTLSYSLGATLYMPGS
FT                   SIQAVNKLIENKIPGLVSTVLCLEDAVDDRYVAHVEKNLNSQLKTLLIMEKKGSFLPFI
FT                   FIRVRSLEQFVRLTEDYEAILPILSGFVFPKFDHSNGHLYFEQLEKINRKAGKTLYGMP
FT                   ILETPGVIHLEKRYETLIEIKSILDKYKELVLNLRIGVTDLSGLYGLRRSCELTIYDIA
FT                   VIRDFIGALVNIFGRPKEGYVISGPVWEYFSSGQRILKSQLRQGYNQFDREYRSIREKL
FT                   LCRYIDGLIREVMLDKANGLIGKTIIHPSHLLPVQALHAVTHEEYCDAKDILSNNNGGV
FT                   SKSVYNNKMNEAKPHTYWAEKVLTLAKIYGVLNDKHDYTSIIYEGDKLQSIG"
     atgagttatt tcagttgttt cagtaaagaa cagaagaaaa agttgttttt tatacctcct        60
     acagagaggt ctttagataa cgataaaaaa acactgtctt attcgctcgg agcaaccctt       120
     tatatgccgg gcagttctat tcaagctgtt aataagttaa ttgagaataa aattccgggt       180
     ctggtatcaa ccgtattatg tctggaagac gcggtcgacg acagatatgt tgcccatgtg       240
     gaaaagaatc tgaacagcca acttaaaacc ctgcttatta tggaaaaaaa ggggagtttt       300
     ctccccttca tttttatcag ggtgcgcagt ttggagcagt ttgtaagact gacagaggat       360
     tacgaagcca tacttcccat attgagtggt tttgtatttc ccaagtttga tcacagtaac       420
     gggcatctct actttgaaca actggaaaag attaaccgga aagccggcaa aacattatac       480
     gggatgccaa tattagaaac acccggtgta attcacctgg aaaaaagata tgaaacctta       540
     atagaaatta aaagtattct ggataaatat aaagaattag tgcttaatct tcgcataggt       600
     gtgacggatc tgtcaggttt atatggtttg cggagaagtt gcgagctgac aatatacgac       660
     attgcagtta tccgtgattt tataggcgct ctggtaaata tttttggcag acccaaagaa       720
     ggctatgtga tttcaggtcc ggtatgggag tatttttctt cggggcagag aatactgaaa       780
     tcgcagctca gacaaggtta taaccagttt gacagagaat accggagcat aagggagaaa       840
     ttgctgtgtc gttacattga cggtttgatt agagaagtga tgctggataa ggccaatggg       900
     ttaatcggta aaacgattat tcacccaagt catttgttgc cggttcaggc gcttcatgcg       960
     gttactcacg aagaatactg tgatgccaaa gatattctgt ccaacaataa tggaggggta      1020
     tcaaaaagtg tttacaataa caaaatgaat gaagcaaaac ctcatacata ttgggcggag      1080
     aaagtgctca ctctggcaaa gatatacggg gtgttaaatg acaaacatga ctacacaagc      1140
     attatctatg aaggagataa attgcaaagt attggataa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page