(data stored in ACNUC7421 zone)

EMBL: CP001720.PE535

CP001720.PE535       Location/Qualifiers
FT   CDS_pept        599882..601207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_O1R66 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61500"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:C8W645"
FT                   /inference="similar to AA sequence:KEGG:APECO1_O1R66"
FT                   /protein_id="ACV61500.1"
FT                   /translation="MDNLSVNIKINENPYDIPVSSVFSMAARNNPKRSYLFVSKLIGKH
FT                   IPVRPIVPFTAGYLLASRLAEYMGLTVNRKKIKEAVSLLSCEQAGDFQPVSYELSGKSL
FT                   FIGFAETATALGHAVYDCFKGNACYLHTTREDLRGTVDTIFFTEAHCHAPEQRCLVCDA
FT                   SLFTNNDLLVLIDDEITTGNTCLNFIKTIQEKYPQKHYIILTILDWRSKEAKEKYALFE
FT                   QELGIKLEVISLYTGSFGCSLSGSAEKEQLSPVNIAVNGKQVILTGEKSELSRVISHNE
FT                   PIGRQINLPGHYSSSYLQYTGRFGINIMDSDGLRKEALRLGRKLSQLRRGEKTLCLGTG
FT                   EFMYIPFLIAAGMGPGIAVQSTTRSPVQAHLRQGYAVQYAVTFTDPFRPNIKNFVYNIK
FT                   PFYYDEVFVFWEREVKPEAVAVLVQSLNGLGIERIVFVSHCR"
     ttggataatc tttcggttaa tatcaagatt aatgaaaatc cttatgacat accggtttcc        60
     agtgtttttt ccatggcagc tcgaaataac cctaaaagaa gctatttatt tgtaagcaaa       120
     ctcattggca aacatattcc ggtgcggccg atagtcccgt ttacagcagg ttatcttttg       180
     gcctcccggc ttgccgaata tatggggctg acagtcaacc gcaaaaaaat caaagaagct       240
     gttagtttat tatcctgtga gcaggccgga gattttcaac cggtttccta tgaattgtcc       300
     ggtaagtccc tgtttattgg ttttgccgaa actgctacgg ctttgggtca tgccgtatat       360
     gactgtttta agggaaacgc ctgttatctg cacaccacca gagaagattt gcgtggtact       420
     gtggatacta ttttttttac agaagcccac tgccatgctc cggagcaaag atgtcttgta       480
     tgtgatgcga gtctttttac aaataatgac ctgcttgttc tgattgatga tgaaataact       540
     accggcaata catgccttaa tttcataaaa actatacagg agaaataccc gcagaaacat       600
     tacataatac tgaccattct tgattggcga tcaaaagagg ccaaagaaaa gtatgctttg       660
     tttgagcagg agttggggat aaagctggag gtgatatccc tttatacagg cagttttggc       720
     tgcagtcttt caggctcagc tgaaaaagaa cagttatctc ctgtaaatat tgctgttaac       780
     ggcaagcagg taatcttaac cggggagaaa agtgagcttt ccagggtgat aagccataat       840
     gagcccatcg gcaggcaaat aaatctgcct ggccattata gttcctctta cctccaatat       900
     accggcagat ttggaattaa tatcatggat tccgatggtt tgcggaaaga ggccttacgt       960
     ttgggaagaa aattgtcaca gttgagaagg ggtgaaaaaa ctctctgtct gggaactggt      1020
     gaattcatgt atataccttt tcttatagct gccggtatgg ggccgggaat agcggttcag      1080
     tctactacca gaagtcctgt tcaagcccat ctaagacagg gttacgctgt tcaatatgct      1140
     gtaactttca cagacccgtt tagacctaat ataaaaaact ttgtttataa tataaaacct      1200
     ttttattatg acgaagtatt tgttttttgg gagagagaag ttaaaccgga ggcagttgct      1260
     gttctggtgc agtcattgaa tgggcttggt attgagcgta tagtttttgt atcccactgc      1320
     cggtaa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page