(data stored in ACNUC7421 zone)

EMBL: CP001720.PE536

CP001720.PE536       Location/Qualifiers
FT   CDS_pept        601207..602397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61501"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:C8W646"
FT                   /inference="similar to AA sequence:KEGG:Noc_1005"
FT                   /protein_id="ACV61501.1"
FT                   /translation="MNFLVEVLNIVMPSGQTKEFLQKGLFIPEPKPIGSYSPDDVIFLL
FT                   KDIGGLIEEQDNEERERLVQNGCHYSEMLPIEYRPNTEYIELFYQSLKETSVRIAHAVG
FT                   LVAMTLLKDPYKKIVLVSLARAGTPAGILIKRYIKLVSGINLPHYSISIIRDKGIDENA
FT                   LLYILRKHPECKLQFIDGWTGKGVIAGELRASLKAFREKYAIEINSSLAVLADPGYCAA
FT                   IFGTREDFLIPSACLNATVSGLVSRTVFRKDLIGDTDFHGAKFYAEMADEDLSNYFIDA
FT                   VSGSFALVREAVSKTLEYNQSAVLDNFPSFRGLRDIERIKEEYGIGNINYIKPGVGETT
FT                   RVLLRRVPWKVLVKDAANPDLKHIFLLAEERGVSVECCPDMSYSCCGLVKTVVDKK"
     atgaattttt tagtggaggt gttaaatata gttatgccat ccggtcagac aaaggagttt        60
     ctgcaaaaag gcctctttat tcctgaacct aagcctatag gcagttacag tcctgacgat       120
     gttatttttc tgcttaaaga tattggcgga ctaatagaag aacaagataa cgaagaaaga       180
     gaaagattag ttcaaaatgg atgccactat tcagaaatgc ttcccattga gtaccggcca       240
     aacacagagt atattgaatt attctatcaa tctctgaaag aaacatctgt tagaatagct       300
     catgccgtag ggcttgtagc catgaccctg ctcaaggatc cgtataaaaa aattgttttg       360
     gtatcccttg ccagagccgg taccccggca ggaattttaa taaaaaggta tattaaactt       420
     gtctccggga tcaatcttcc tcattacagt atttccatta tccgtgataa aggcattgat       480
     gaaaacgctt tgctatatat tttgcgaaag cacccggagt gtaaactcca gttcattgac       540
     ggttggacgg gcaagggggt aatagccgga gagcttaggg catcattaaa agcattcaga       600
     gaaaaatacg ctatagaaat caacagcagt ttagctgtgc ttgccgatcc tggttattgt       660
     gccgctattt ttggtaccag ggaagatttt ttaattccca gtgcttgcct taatgccaca       720
     gtgagtggtt tggtttccag aaccgttttc agaaaagatc tcattggcga tacagatttt       780
     cacggcgcca agttttatgc tgagatggcg gacgaagatt tgtcaaatta ttttatagat       840
     gcggtcagcg gctcctttgc tctggtgaga gaggcagtaa gtaaaactct tgaatataat       900
     caaagcgctg ttttggataa ctttccttct ttccgtggtt taagagatat cgaaagaata       960
     aaagaggaat atggtattgg caatataaac tatatcaaac cgggtgtggg tgagacgacc      1020
     agagtgctgc tgcgccgtgt tccctggaaa gtgctggtta aggatgctgc caaccctgat      1080
     ctcaaacata tatttttatt ggctgaagaa aggggtgttt cagtggaatg ctgcccggat      1140
     atgagctatt cctgctgcgg attggttaaa acggtggtgg ataagaaatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page