(data stored in ACNUC7421 zone)

EMBL: CP001720.PE537

CP001720.PE537       Location/Qualifiers
FT   CDS_pept        602394..603230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61502"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W647"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61502.1"
FT                   /translation="MIFASDLDRTLIYSERFLPGYIGKVEAVEQGKYISFMTEKSVELI
FT                   TGLFTQLIFVPCTTRTIEQYRRIRFFNRQYIPKFAVVSNGGNIIVDGVVHEGYRNNIAQ
FT                   KLSDNCLAGSQLLKEFEELASGEWSGRLVSADGLFYYCIIDRAKAPLEQIDAFADWALD
FT                   QNWEVSLQGRKLYLVPRLVNKWSAVEKIKELTGEQVVFAAGDSLLDLSMIENANQAIYP
FT                   AHGELYERFGKSLLNSRGQSVAATAVAGLAAAEQILLEAARFKEYGWNDKKAINNN"
     atgatttttg ccagtgatct tgaccggact ctcatttatt cagagaggtt tctgcccggt        60
     tatattggaa aggtcgaagc cgtggagcaa ggcaaatata tttctttcat gactgaaaag       120
     tcagtagaat taataaccgg tttatttact caactaattt ttgttccctg taccaccagg       180
     acaatagagc agtatcggag aatccgtttt tttaaccgtc aatacatccc caaatttgct       240
     gtggttagca atggaggcaa tataattgtc gacggggttg tgcatgaagg ctatagaaat       300
     aatattgcac aaaagctatc tgataattgt ttggccggtt cacaactttt aaaggagttt       360
     gaggagcttg cttccggtga atggtctggc cggttggtta gtgcggacgg tttattctac       420
     tactgtataa ttgaccgggc aaaggcccct cttgaacaaa tagatgcatt tgctgattgg       480
     gccttagatc agaactggga agtctccttg caggggagaa agctttacct ggttcccaga       540
     ttagttaaca agtggtctgc tgtagaaaag ataaaagagc taaccggaga gcaggtagtt       600
     tttgctgccg gtgattcact attagactta tccatgattg agaatgctaa ccaggcgatt       660
     taccctgccc atggtgagtt atatgaaagg tttggtaaat ccctgctgaa tagccgcggt       720
     cagtccgtag ctgcaacagc agttgccggc ctggctgccg cagagcaaat attgttggag       780
     gcagcaaggt ttaaggagta tggatggaat gataagaaag caataaataa taattaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page