(data stored in ACNUC7421 zone)

EMBL: CP001720.PE541

CP001720.PE541       Location/Qualifiers
FT   CDS_pept        complement(606575..606892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W651"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61506.1"
FT                   /translation="MCFTKNTLPDFTCKFFWDVDTRKIDICENYRFVLERLLEYGDDQT
FT                   LKWLMSFYSDKQRLEVIKNSRIKFFLQNSEKILLNLKLVLKRNKDLKCLNSSFLFVLSL
FT                   I"
     atgtgcttta ctaaaaatac acttcccgac tttacctgta agttcttttg ggatgtagat        60
     acgagaaaaa ttgacatctg tgagaattat cgttttgtac ttgaacgatt actggaatac       120
     ggtgatgacc aaacattaaa atggctgatg tctttttaca gtgataagca aaggctggaa       180
     gttataaaaa acagcagaat taagtttttt ttacaaaact ccgaaaagat tttattaaac       240
     ttgaaactag ttttaaagag gaacaaagac cttaaatgtc ttaattcctc ttttttgttt       300
     gttctttcgc ttatttaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page