(data stored in ACNUC7421 zone)

EMBL: CP001720.PE542

CP001720.PE542       Location/Qualifiers
FT   CDS_pept        complement(607140..607931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0587"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61507"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W652"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61507.1"
FT                   /translation="MYQESGVLIELPPGALKYRATIMLENTPYNKITPVNDLYVYKSVD
FT                   INTIKNGGSTITSLEKLARISFFFDYIDFKRASQLNTNLSMGHFRIAYWDDTIQNWKQL
FT                   PSQVFWNEDKNQGMVEAEIDRSKARYALLWSNRQGEQLSPVSTGGIRIMVNYIPVKAQV
FT                   APYIKNGRTMVPLRAIAESLGAQVYWISSEQRIELLQNMNKLQLWIGKSTALKDGQSLL
FT                   LDVEPEIAGGYTFVPLRFVSEAFGAKVSWDEITKTAKVVSN"
     atgtaccagg aatcaggagt attaatagaa ctgcccccag gtgcacttaa gtatcgcgcc        60
     actattatgc tggaaaacac cccgtacaac aaaataactc ccgttaacga cttgtacgtt       120
     tacaaatccg ttgatattaa cactatcaaa aacggcggca gcacaataac ctctctggaa       180
     aagctggctc gtatcagttt cttttttgat tatattgatt ttaaacgggc ttcccaattg       240
     aacactaact tatcaatggg acattttaga attgcttatt gggacgacac tatacaaaat       300
     tggaagcaat taccctcaca ggtattctgg aatgaagata aaaaccaggg aatggttgaa       360
     gctgaaatag accggagcaa ggcgcgttat gctcttcttt ggtcaaatag acaaggggag       420
     caattaagcc cggtttctac aggtggaatc cgtattatgg ttaactacat accggttaaa       480
     gctcaggttg caccttatat aaagaacggt agaaccatgg ttcctttgcg ggccattgct       540
     gaaagcttag gagcacaagt atactggatt agctctgaac agcgcattga attgctgcaa       600
     aatatgaaca aactgcagct gtggatagga aaatccacag ctttgaaaga cggccaatcc       660
     ttattgcttg atgtagaacc cgaaatagcc ggtggctaca cttttgtacc cctgcgtttt       720
     gtctccgagg cttttggcgc aaaggttagc tgggacgaga ttactaagac ggccaaggtt       780
     gtcagcaatt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page