(data stored in ACNUC7421 zone)

EMBL: CP001720.PE543

CP001720.PE543       Location/Qualifiers
FT   CDS_pept        609064..609945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0588"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: baa:BA_2352 aminotransferase class IV;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61508"
FT                   /db_xref="GOA:C8W653"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C8W653"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACV61508.1"
FT                   /translation="MGLIIYLNGNYVPEEQAVVSVFDHGLLYGDGVFEGIRAYHNRVFK
FT                   LEEHIKRLYESAKTIMLDIPLSMEKMSEVVLETLRRNNQRDAYIRLVVTRGKGDLGLDP
FT                   RKCTKATVFCITASIQLYPEELYNNGLITVTVPTRRNAGEAVNPRVKSLNYLNNIFAKI
FT                   EANLAGVPEAVMLNNEGYVAEATGDNIFIIKDGVLITPPVYAGLLEGITRNCVIEIART
FT                   KGIPVVETLFTRHDIFIADECFLTGTAAECIPVVQVDGRSIGNGKPGPMTHSLMKAFHE
FT                   LTETDGPQIFPE"
     atgggtttaa tcatctatct aaacggtaat tacgtgccgg aggaacaagc agttgtatca        60
     gtattcgatc acggcctgct gtatggggac ggggtatttg aaggtatccg ggcttaccac       120
     aaccgggtgt ttaaactgga agaacacatc aagagacttt atgagtcggc caaaaccatt       180
     atgctggata tccccttgag catggagaaa atgagtgagg ttgttttgga aacactgcgc       240
     cgcaacaacc agagggatgc ttatatacgc ctggtagtta cccgaggcaa aggtgacctg       300
     ggtttagatc cccgcaaatg cacgaaagct acagtatttt gcattaccgc cagcattcaa       360
     ctttatccgg aagaattgta caacaacggt ttaattactg tcactgtacc gactcgcaga       420
     aatgcgggtg aggctgttaa tcccagggta aaatctctta actatttgaa taatattttc       480
     gctaagattg aagctaacct ggcaggtgtg cctgaagccg tgatgctgaa caatgaaggt       540
     tatgtggccg aagctaccgg cgataatatt ttcattatta aagacggtgt tttaatcaca       600
     ccgcccgtgt atgccggttt gctggaaggc attactagaa attgtgttat agagatagcc       660
     aggactaaag gtattccggt agtggagact cttttcacca gacacgatat atttatagcc       720
     gatgaatgtt tcttaacagg cactgccgcc gaatgtattc cggtagttca ggtggacggc       780
     aggtcaattg gcaatggtaa accaggtccc atgactcata gcttgatgaa agccttccat       840
     gagttgactg agacagacgg accgcagatt tttcctgaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page