(data stored in ACNUC7421 zone)

EMBL: CP001720.PE545

CP001720.PE545       Location/Qualifiers
FT   CDS_pept        611741..613402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0590"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: dol:Dole_2037 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61510"
FT                   /db_xref="GOA:C8W655"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8W655"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACV61510.1"
FT                   /translation="MKLSGAEILVKCLKEHGVDTIFGYPGGVVLPIYDALYDADIRHIL
FT                   TRHEQGAVHAADGYARATGKAGVCLATSGPGATNLVTGLTNAYMDSIPMVAFTGQVATA
FT                   LLGRDSFQEADITGITMPITKHNYLVKDVSELARTIKEAFYIANTGRPGPVLVDLPRDV
FT                   SAGIIEYQAPGPINLPGYNPIIEPFEEQVVLAANAVNESVRPIIYAGGGVVSSGAHEEL
FT                   LALAEKIKAPVTNTLMGLGGFPGEHPQFLGMLGMHGTKAANFAMCETDLVIAVGARFDD
FT                   RVTGKLDDFAKDAKIIHIDIDPAEIGKNVGTHFPVIGDVKIALQRLLERIEEKSLTEWL
FT                   AKCMTWKREYPLAFFNEGGLKPQSIISEINRLTLDKKVRITTEVGQHQMWAAHYYNYNY
FT                   PRTFISSGGLGTMGYGFPAALGVQAACPDELVIDISGDGSFQMNIQELATAVNYELPVK
FT                   VAILNNGYLGMVRQWQELFYDKRYSYTELKNPDFVKIAEAYGAVGIRVTTRDEVAPALE
FT                   EAFAINKPVVLDFVTEREENVYPMVPPGCELKNMLG"
     atgaagcttt ccggggcgga aattttagtc aagtgtttaa aggaacacgg agtggataca        60
     attttcgggt atcctggcgg tgtggtattg cctatatatg acgcactcta cgatgcggat       120
     atcaggcaca ttttgaccag gcatgagcag ggggcagtgc atgctgctga cggctatgcc       180
     agagctaccg gaaaggccgg ggtttgtttg gctacctccg ggcccggtgc gaccaacctg       240
     gtaaccggtt tgaccaatgc ctatatggat tccattccaa tggtagcttt taccgggcag       300
     gtagcgactg ctcttttagg cagagactct tttcaggaag cagacataac aggtattacc       360
     atgccaataa ctaaacacaa ttatttggtg aaggatgtca gcgaattggc tcgcaccata       420
     aaagaggctt tttatatagc caataccggt aggccgggac cggtgctggt ggatttgccc       480
     agggatgttt ctgccggcat aatagagtat caagcacccg gacccattaa tttacccggt       540
     tataacccaa ttatcgagcc gtttgaggag caagtggtgc tggcggccaa tgctgttaat       600
     gaatctgtcc gcccgataat atatgccggc ggcggtgtgg tttcttccgg tgcccatgaa       660
     gaattgctgg cactggcgga aaagataaag gctccggtaa ccaatacttt gatggggctt       720
     ggcggttttc ccggtgagca cccgcagttt ttaggcatgc tgggtatgca cggtaccaaa       780
     gccgctaatt ttgccatgtg tgaaaccgat ctggttattg ctgtgggggc gagatttgat       840
     gaccgggtta ccggtaagtt ggatgatttt gccaaagacg caaagatcat tcatatagat       900
     attgacccgg cggaaatagg taaaaatgtc ggcactcatt ttcctgttat aggtgatgtg       960
     aaaattgctt tgcaaaggct gctggaacgc attgaagaaa agtctcttac ggaatggctg      1020
     gccaagtgca tgacctggaa aagggaatat cccctggcct tctttaacga aggcggcttg      1080
     aagccccaat caatcatcag tgagattaat cgtctgacac tggataaaaa ggtgcgtatt      1140
     accacggagg taggtcagca ccagatgtgg gccgcccatt actataacta caactatccc      1200
     aggactttca tctcttctgg cggcctgggc actatgggtt acggtttccc tgccgctctg      1260
     ggtgtgcagg cggcttgtcc tgatgagctg gttattgata tatcgggtga cggcagcttt      1320
     cagatgaaca tacaggagct ggccacagca gttaattatg aactgccggt taaggtggct      1380
     atactcaata acggttatct gggcatggtt agacagtggc aggaactttt ctatgataag      1440
     cgctattcct acaccgaact taaaaatcct gattttgtta aaatagctga ggcatacggt      1500
     gctgtgggta taagagtaac tacacgtgat gaagtggctc ctgctctgga agaagctttt      1560
     gctatcaata aaccggtggt tttggacttt gtgacggaga gggaggaaaa cgtgtatccg      1620
     atggttcctc ccggctgtga actaaagaat atgctcggtt ag                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page