(data stored in ACNUC7421 zone)

EMBL: CP001720.PE546

CP001720.PE546       Location/Qualifiers
FT   CDS_pept        613436..613936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0591"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3022
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61511"
FT                   /db_xref="GOA:C8W656"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C8W656"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACV61511.1"
FT                   /translation="MLHTLAVLVENNPGVLARVSGLFSRRGFNIDSLAVGRTDDPTISR
FT                   MTIVVEGDDQVLEQVRKQLNKLVDVIKIDDISSERHVDRELIIIKVNADTQTRSEIMQI
FT                   VDIFRAHIVDIGQETLIVEASGDSGKVNGLEEALKPFGIKEVARTGKIAMLRGAKATSL
FT                   NED"
     atgctgcata cgcttgctgt gctggtagaa aataacccgg gggtactggc ccgggtatca        60
     ggtttgttca gtcgccgagg ttttaatatt gacagtctgg ctgtaggcag aacagatgat       120
     ccaacgattt cccgtatgac cattgttgtt gaaggtgacg atcaggttct cgaacaggtg       180
     cgcaagcagc tgaacaagct ggtggatgta attaaaattg acgacatatc ttctgagaga       240
     catgttgaca gagaattaat aatcatcaag gttaatgcag atacccagac cagatcggaa       300
     atcatgcaga tagtggatat tttcagggcg catattgtgg atatcggtca ggaaacatta       360
     atagttgaag ccagcgggga ttccggtaag gttaacggtt tggaagaagc cttaaaacct       420
     ttcggtatca aagaagtggc ccgtacaggt aagatcgcta tgttaagagg tgctaaagcc       480
     acatccttaa atgaggatta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page