(data stored in ACNUC7421 zone)

EMBL: CP001720.PE547

CP001720.PE547       Location/Qualifiers
FT   CDS_pept        613939..614031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61512"
FT                   /db_xref="UniProtKB/TrEMBL:C8W657"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61512.1"
FT                   /translation="MEVINPAIAVNGMIVKILLYGLKCCCLHVY"
     atggaggtga ttaatcccgc aattgcggtt aatggaatga tagttaagat tttattatat        60
     ggtttaaagt gttgctgttt gcatgtatac taa                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page