(data stored in ACNUC7421 zone)

EMBL: CP001720.PE548

CP001720.PE548       Location/Qualifiers
FT   CDS_pept        614080..615075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0593"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: dvl:Dvul_1690 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61513"
FT                   /db_xref="GOA:C8W658"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W658"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACV61513.1"
FT                   /translation="MVQVYYDQDADLSLLAGKKIAVMGYGSQGHAQAQNLKDSGVDVVV
FT                   GLRRDSKRWAQAEADGLAVATVAEAANQADIIQILLPDETQAKVYNEEIAPNLSEGNVL
FT                   MFSHGFNIHFGQIVPPANVDVIMVAPKSPGHMVRRMYVDGAGVPCLVAVHQDYSGKAKD
FT                   IGLAYAKGLGGTKAGVFETSFKEETETDLFGEQAVLCGGLCELIQAGFDTLVEAGYAPE
FT                   MAYFECLHEVKLIVDLINEGGLNFMRYSISNTAEYGDYMTGKRIITEETRKEMKQVLAE
FT                   IQNGVFARNWMLENQVNRPVFNAIKKAQSESQIEVVGAGLRKMMPWLKKK"
     gtggttcaag tgtattatga tcaggatgcg gatttaagtt tgctggcagg taaaaagatt        60
     gcagttatgg gttatggcag ccagggccat gctcaggcac agaatttaaa agacagtggt       120
     gtggatgtag tagtaggttt gagacgtgac agcaagcgct gggcacaggc agaagctgat       180
     ggtttggccg tggccaccgt agctgaggct gccaatcagg ctgatattat tcagatactc       240
     ctgccggatg aaacccaggc taaagtatat aatgaagaga ttgctcccaa tttatccgag       300
     ggcaatgtat tgatgttttc tcacggcttt aatattcact tcgggcaaat tgtgccgcct       360
     gctaatgttg atgtaattat ggtagcgccg aagagccccg gtcatatggt gcgcagaatg       420
     tacgttgacg gtgccggtgt tccctgcctg gtggccgtgc atcaagacta ttccggcaag       480
     gccaaggata tcggtttggc ctatgccaag ggtttgggcg gcaccaaagc cggtgttttt       540
     gaaaccagtt ttaaagaaga gactgaaact gatctgtttg gagagcaggc agttctctgc       600
     ggcggtctgt gcgaattaat ccaggcaggt tttgacaccc tagtggaggc gggatacgca       660
     ccagaaatgg cttatttcga gtgcctgcac gaagttaaat tgatcgtaga cttgatcaat       720
     gagggtggct taaacttcat gcgctattcc atcagcaaca ctgccgagta cggtgattat       780
     atgacaggca agcgcatcat caccgaggaa acccgtaaag aaatgaaaca ggtgctggcg       840
     gagattcaga acggcgtgtt tgcccgcaac tggatgctgg aaaaccaggt taaccgcccg       900
     gtatttaatg ccattaagaa agctcagtcc gaaagtcaaa ttgaagttgt cggtgccggt       960
     ttgagaaaaa tgatgccctg gttgaagaag aaataa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page