(data stored in ACNUC7421 zone)

EMBL: CP001720.PE549

CP001720.PE549       Location/Qualifiers
FT   CDS_pept        615176..616849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0594"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: sfu:Sfum_2981 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61514"
FT                   /db_xref="GOA:C8W659"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8W659"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACV61514.1"
FT                   /translation="MGITVAEALVLCLERENVEVIFGYPGGAILPVYDALYKSNKIKHV
FT                   LVRHEQGAAHAADGYARATGKVGVCMATSGPGATNLVTGIANAYMDSVPIVAFTGQVPT
FT                   GMVGTDAFQEVDITGITMPVVKHNYFVKDPKQVPKIVREAFYIARTGRPGPVLIDLPKD
FT                   VTSAIIDYEEVEEINLRGYKPNYRADDEQVEKAAEMIKKSQCPVIYAGGGVVSAGAHDE
FT                   LKVLAETIGAPVTHTLLGLGGFPGDHPLFAGMLGLHGAMYANKIVTECDLLITLGARFD
FT                   DRVTGKIAGFAPDASVIHVDIDPAEIGKNVRVHLPVAGDVKTVIQQIIPLLEQKNNRQW
FT                   LERFAELKKQYALRYEPAAGEGLKPQQVIEKLNEVAQGNAIICTDVGQHQMWAAHYYRH
FT                   IQPRSFISSGGLGTMGYGYPAAIGAEFGCPGKQVILISGDGSFQMNLQEMATVMEQGLS
FT                   VKVIVLNNGRLGMVRQLQEFYCDKRYMAVDFSYHPDFAGIARVYGMKGFDIKTSEELNA
FT                   ILPEVLSSQGPAIINCFVQEDENVYPMVMAGKCIDEAIEG"
     atgggaatta ctgtcgcgga agccctggta ctgtgtttgg agcgggaaaa cgtggaagtt        60
     atcttcggtt atcctggtgg tgcaatcctc cctgtatatg atgcacttta taaatccaat       120
     aaaattaaac acgtactggt gcgccatgaa cagggggccg cgcacgcggc tgacggttat       180
     gcccgtgcta ccggcaaggt aggtgtttgc atggctactt ccggtcccgg agccacaaac       240
     ctggtgacag gtattgctaa tgcctatatg gattcagtgc ccattgtggc ttttaccggg       300
     caggtgccga ccggcatggt gggtacggat gccttccagg aagtggatat tacaggtatt       360
     actatgcctg tagttaagca taactatttt gttaaagatc ccaaacaggt acctaaaatt       420
     gttcgcgagg ccttctatat tgcccgtacc ggcaggccgg gcccggtatt gatagatttg       480
     cccaaagatg ttacttcggc tataattgat tatgaagaag tggaagaaat caacctgcgc       540
     ggatataaac cgaattacag ggctgacgat gaacaggtgg aaaaagccgc agagatgatc       600
     aaaaagtctc aatgcccggt tatttatgcc ggaggcggtg tggtcagtgc gggtgctcat       660
     gatgagctga aagtgctggc tgagactatc ggcgctccgg tgacccatac cctgctgggg       720
     ctgggcggtt ttcccggtga tcacccgctt tttgccggta tgctgggact gcacggggca       780
     atgtatgcca ataagattgt taccgaatgt gacctgttga taactctggg cgctcgtttt       840
     gatgaccggg ttacaggtaa aatcgccggt tttgcgcccg acgccagtgt tatacacgtg       900
     gatattgatc cggcggaaat cggcaagaat gtacgcgtgc acttgcccgt ggccggtgac       960
     gtaaagacgg ttatccagca gattattccc ctactggagc agaaaaacaa ccggcagtgg      1020
     ctggaacgct ttgctgaatt aaaaaaacaa tacgctctgc gttatgagcc ggcggcagga      1080
     gaaggtttaa aacctcagca ggtaattgag aaactaaatg aggtggcaca gggaaatgct      1140
     atcatttgta cagatgtagg ccagcaccag atgtgggcag ctcattatta ccggcatatc      1200
     cagccccgtt ccttcatctc ttccggaggt ttgggcacta tgggctacgg ctacccggcg      1260
     gctatcggag ctgaattcgg ctgtcccggt aagcaggtta tactgatttc gggtgacggc      1320
     agttttcaaa tgaatttaca ggaaatggcg acagttatgg aacagggcct atcggttaaa      1380
     gttatagttt taaacaacgg acgcctgggc atggtgcgcc agctgcagga attttattgc      1440
     gacaaacgct atatggccgt ggatttcagc tatcacccgg actttgccgg tattgccagg      1500
     gtttacggaa tgaagggttt tgacattaaa acttcggaag aattaaatgc catattgccg      1560
     gaggtattga gttcacaggg tccggctatt atcaactgct ttgtgcagga ggatgaaaac      1620
     gtttacccga tggttatggc cggtaaatgt atagatgaag ccattgaggg gtag            1674
//

If you have problems or comments...

PBIL Back to PBIL home page