(data stored in ACNUC7421 zone)

EMBL: CP001720.PE551

CP001720.PE551       Location/Qualifiers
FT   CDS_pept        618467..619729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0596"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; homoaconitate hydratase family protein; 3-
FT                   isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: sat:SYN_00091 3-isopropylmalate
FT                   dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61516"
FT                   /db_xref="GOA:C8W661"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C8W661"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ACV61516.1"
FT                   /translation="MGMTVTEKILAAHAGKDKVVPGELVNVKVDLALGNDITAPVAIKE
FT                   FSKIGVDSVFDREKIALVLDHFIPAKDIASAEQGKAVKNFAQKHGIVNFFDVGKMGIEH
FT                   CLLPEQGLVGPGDLVIGADSHTCTYGGLGAFSTGVGSTDLAAAMALGETWLKVPESMLF
FT                   VFEGELRPWVGGKDLILHIIGDIGVDGALYKAMEFAGPAIEKLSMDGRLTMANMAIEAG
FT                   GKNGIVAPDEITRAYVEGRVKKPYTFYKSDADAVYSDIRRYDASKIEPLVAFPHLPENT
FT                   RPVSQAGLVELDQVVIGSCTNGRMEDLRLAAGVLKGKKVSDRIRLIVIPGTQQIYKQAM
FT                   REGLIEIFIDAGGAVSTPTCGPCLGGYMGILAKGERSLATTNRNFVGRMGSPESEVYLC
FT                   NPAVAAASAILGRIAGPWEVE"
     atgggaatga cggtaactga aaaaatactg gccgcacacg cgggcaaaga taaagtagtg        60
     cccggcgaac tggtgaatgt caaggttgac ctggctttag gaaacgatat caccgcgccg       120
     gtagcgatta aagaatttag taaaataggt gtggattctg tttttgaccg tgaaaaaatt       180
     gccctggtgc tggatcactt tatcccggcc aaagatattg cctcggccga acagggcaaa       240
     gcggttaaaa actttgctca gaaacacggt atagtaaatt tctttgatgt gggcaaaatg       300
     ggtatagaac actgtctttt gcccgagcag ggtttggtcg gccccgggga tttagtcatc       360
     ggggcggact ctcatacctg cacttacggc ggcttaggcg ctttctccac cggtgtgggc       420
     agcacggatc tggctgctgc catggcactg ggagaaacct ggctgaaagt gccggaaagc       480
     atgctctttg tttttgaagg cgagctccgg ccctgggtgg gcggcaagga tttaattctg       540
     cacatcatcg gggacatcgg agttgacggt gcattataca aagctatgga atttgccggg       600
     ccggccattg aaaagctgtc catggacggg cgtttgacta tggccaacat ggctattgag       660
     gcaggcggta agaacggtat tgtggcgccg gatgaaatca cccgggctta tgtggaaggc       720
     agggtgaaga agccctatac tttctataag agcgatgctg atgctgtcta cagcgatata       780
     cgccgctacg atgcctcgaa aatcgagccg ctggtagctt tccctcacct gccggaaaac       840
     accagaccgg tcagtcaagc cgggttggtt gagctggatc aagtggttat cggatcctgc       900
     accaatggtc ggatggagga tttgcgcctg gcagccggtg tgttgaaggg gaaaaaggtc       960
     agcgacagaa ttcgtttaat cgtaatcccc ggcacacagc aaatttacaa gcaggctatg      1020
     cgcgagggct tgattgagat ctttatcgat gccggcgggg cggtcagcac acctacctgc      1080
     ggcccttgtc tgggcggtta catggggata ctggccaaag gagaacgttc tctggctact      1140
     accaaccgca attttgtcgg acgtatgggc tcaccggaaa gcgaagttta tctctgcaac      1200
     ccggcagtag cagcagcttc tgctattttg ggccgaattg ccggaccctg ggaggtggag      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page