(data stored in ACNUC7421 zone)

EMBL: CP001720.PE552

CP001720.PE552       Location/Qualifiers
FT   CDS_pept        619730..621301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0597"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; 3-
FT                   isopropylmalate dehydratase, small subunit; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; aconitate
FT                   hydratase domain protein; KEGG: dvm:DvMF_1794
FT                   3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61517"
FT                   /db_xref="GOA:C8W662"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C8W662"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACV61517.1"
FT                   /translation="MGLKGKAWKFGADIDTDAIIPARYLNTSDPVELAKHCMEDADTSF
FT                   AQKVQPGDVIVADKNFGCGSSREHAPISIKYAGVSCVIAKSFARIFYRNAFNIGLPILE
FT                   STEAVEGIDEGNEVSVNAETGTITNVTKGETYQATVVPPFMQQIIAAGGLINYVAERMK
FT                   VKKMYKIAVLPGDGIGPEITEQALKALKAVAEHFGHEFQFTEALVGGAAYDAVGHPLPK
FT                   ETLDLCYSSDAILLGAVGGDKWADLPPELTPERGALLPLRKLLGLYANLRPAVVFPALA
FT                   NASTLKPEVVEGLDIMVVRELTGGLYFGEKKREDLPDGTVRVTDTLVYTTEEIVRIARL
FT                   AFELAAKRRKKVTLVDKANVLESSRYWREVVANMAAEYPDIEFNTMYVDNAAMQLVKMP
FT                   KQFDVIVTDNMFGDILSDQASQLTGSLGMLASASIGGKIGLYEPSHGSAPKYAGLKRAN
FT                   PIATVMSGAMLLRYSFDMEKEAKAIEDAVTEVLKKYRTRDIMEEGLQLVNTDEMGDRIA
FT                   EQILAG"
     atgggattaa agggtaaagc ctggaagttc ggagccgata ttgacacaga tgccattatt        60
     ccggcccgtt acttaaatac ttctgacccg gttgaactgg ccaaacattg tatggaagat       120
     gccgatacct cttttgcgca aaaagttcag cccggggatg tgattgtagc tgataagaac       180
     ttcggttgcg gcagttcgcg tgagcatgcc ccgatatcca tcaaatatgc cggagtctcc       240
     tgcgtgattg ccaagtcttt tgcccgtata ttttaccgga atgctttcaa tatcgggctg       300
     cctattctgg aatcaacaga agcagtggaa ggtatagatg aaggaaatga ggtttccgtt       360
     aatgcggaaa caggtactat taccaatgtg accaagggag agacctatca agctacggtg       420
     gtgcctccgt ttatgcagca aataattgcc gcaggtggac ttattaacta tgtcgcagaa       480
     aggatgaagg ttaagaaaat gtataagatt gccgtacttc ccggagatgg aatcggaccg       540
     gagattactg aacaggcgtt aaaggcctta aaagccgtag cggaacattt tggccatgaa       600
     tttcagttta ccgaagcctt agtcggcgga gctgcctatg acgcggtggg acacccgctg       660
     ccgaaagaaa ctttggacct gtgctacagc agcgatgcca ttttgctggg tgctgtaggt       720
     ggtgacaagt gggctgatct gcctcctgaa ttaactccgg aaagaggagc actcctgccc       780
     ttgcgcaaat tattgggcct ctatgctaac ctgcgcccgg cagtggtatt cccggcactt       840
     gccaatgcct ccaccttaaa gccggaggta gtggaaggtt tggatattat ggtagtgcgt       900
     gaactgaccg gaggtctcta cttcggcgag aagaagagag aagatttgcc ggacggcact       960
     gttcgtgtaa ccgatacgct ggtttacacc actgaggaaa tcgtgcgcat agcccgcctg      1020
     gcttttgagc tggctgctaa gaggcgtaag aaagtcaccc tggtggataa ggccaatgtg      1080
     ctggaatctt cacgctactg gcgtgaagta gttgccaata tggctgctga gtatcccgat      1140
     attgagttta ataccatgta tgtggataat gcggctatgc agttggtaaa aatgcctaaa      1200
     cagtttgacg taattgttac tgataatatg ttcggtgata ttttaagcga tcaggcttcc      1260
     cagcttaccg gttctctggg catgctggct tccgccagta tcggcggtaa aatcggcttg      1320
     tatgaaccca gccatggttc agcgcctaaa tatgccggtt tgaaaagagc taacccaatc      1380
     gctacggtaa tgtcaggagc catgctgctg cgctattcct tcgacatgga gaaagaagct      1440
     aaggccatag aagacgcggt taccgaggta ttgaaaaaat atcgcaccag ggatattatg      1500
     gaggagggcc tacagttagt caacactgac gagatgggcg accgtatagc cgaacagatt      1560
     ttagccggct aa                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page