(data stored in ACNUC7421 zone)

EMBL: CP001720.PE553

CP001720.PE553       Location/Qualifiers
FT   CDS_pept        621590..623155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0598"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; KEGG:
FT                   gsu:GSU1798 alpha-isopropylmalate/homocitrate synthase
FT                   family transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61518"
FT                   /db_xref="GOA:C8W663"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:C8W663"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACV61518.1"
FT                   /translation="MSTIEIYDTTLRDGAQGEGISFSVEDKVKIALRLDKLGVHYIEGG
FT                   WPGSNPKDSDFFKRIKDFPLEKAVVSAFGSTRKPNSDVKEDVNLKAIVDAGVQVACIFG
FT                   KTWDFQVVYALNTTLEENLQMIKESVAYLKSNGMQVFYDAEHFFDGCKANTEYALETVK
FT                   AAQAGGADRIVLCDTNGGTMPWDIQEIVSKVKSVVTVPLGIHCHNDSEMAAANSVIAVQ
FT                   SGVIQVQGTMNGYGERCGNANLCSVIPNLEIKCGLKCLPEGNLAQLTEVSRFVSEVANM
FT                   HLHNGQPFVGTSAFAHKGGIHVSAIMKNSKTYEHITPELVGNQRRVLVSDQSGLSNLLY
FT                   KFKELNVDLTQQTEENKQLLMHIKELENQGYQFEGADGSFELLMRRISGQYENPFKLES
FT                   LRVIMDMKENGPTSTEATIKIWVGDQVKHTAAEGNGPVNALDNALRKSLEGFYPAIKEM
FT                   QLNDYKVRVLNEKEGTDAVVRVSIETGDGKNSWGTIGVSTNIMEASWQALVDSLAYGLL
FT                   KQND"
     atgtcaacta tagaaatata tgatactact ttgcgtgatg gcgcccaggg ggaaggcata        60
     tccttttctg tagaggataa agtaaaaatt gcgctgcgct tggataaatt gggtgttcat       120
     tacatcgaag gaggttggcc tggctccaac cccaaggatt ccgatttttt taagcggatt       180
     aaagactttc ccctggagaa ggccgtagtt tcagcctttg gcagtaccag aaagccgaat       240
     agcgatgtga aagaggatgt gaacctgaaa gctattgtcg atgccggtgt gcaggtagcc       300
     tgtatatttg gcaagacatg ggatttccag gttgtgtatg cgctcaatac tactctggaa       360
     gagaatttac aaatgattaa agaatcagtt gcctacctga agtcaaacgg catgcaggta       420
     ttttatgatg cggaacattt ttttgacggc tgtaaggcca atacagagta tgcattggaa       480
     actgttaaag cggcccaggc gggtggagcg gaccgtattg tgctctgtga taccaatggc       540
     ggaaccatgc cctgggatat tcaggaaata gttagtaaag taaagagtgt tgtcacagtt       600
     cctctgggta ttcactgcca taacgacagt gaaatggctg cagccaattc tgttatagcg       660
     gttcagtccg gggttataca ggttcagggt actatgaacg gttatggaga gcgctgcggc       720
     aacgccaatc tctgctcggt aattcctaat ctggaaataa agtgcgggct taaatgtttg       780
     cctgaaggta acctggcgca gcttacggag gtttcccgct ttgtcagtga ggttgccaac       840
     atgcacctgc ataacggcca accttttgtg ggtaccagtg cttttgccca taaaggcggc       900
     attcatgtca gcgccattat gaaaaattcc aaaacgtatg agcatattac tccggaattg       960
     gtgggcaacc agcggcgggt tctggtctct gaccagtctg gattatccaa tttgctttat      1020
     aaattcaaag agctgaatgt ggatttaacc cagcagacag aagagaataa gcaactgctc      1080
     atgcatataa aggaactgga gaaccaggga taccagtttg agggagcgga tggttctttt      1140
     gaactgttaa tgagacgcat atcgggtcag tatgaaaatc ctttcaaact ggaaagcttg      1200
     cgggtcatca tggatatgaa ggaaaacggg ccgaccagca ccgaggcaac cattaaaatc      1260
     tgggtgggcg atcaggtcaa acacacggct gcggaaggca acgggccggt caatgcactg      1320
     gataatgccc tgcgtaaatc cttggaaggt ttttacccgg ctattaaaga gatgcaatta      1380
     aacgattaca aggtgcgcgt gctcaatgaa aaagagggca ctgacgcggt ggtgcgggtt      1440
     tcgattgaaa caggtgacgg taaaaattcc tggggtacaa tcggtgtatc aacgaacata      1500
     atggaagcaa gctggcaggc gctggtagac agcctggcct acggtttgtt gaagcaaaat      1560
     gattga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page