(data stored in ACNUC7421 zone)

EMBL: CP001720.PE555

CP001720.PE555       Location/Qualifiers
FT   CDS_pept        625024..626307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0600"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: dat:HRM2_03800 KamA1; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61520"
FT                   /db_xref="GOA:C8W665"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:C8W665"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACV61520.1"
FT                   /translation="MKQKLLFANITEESNWSDWRWQLRNRIMSSDELDQYANLSVYEKA
FT                   SIQKAIDVFPMAITPYYASLINKDDSTCPIRMQCIPNPKELIKGSGDMDDPLHEDGDSP
FT                   CPGLTHRYPDRVLLLVTNECSMYCRHCTRKRKVGDNEKVSKDSDIIKAIEYIKAHPDIR
FT                   DVLLSGGDPFVLSTNRLEQIIRRVREIPHVQVIRIGTRTPVVMPQRITDHLVKMLKKYH
FT                   PIWINTHFNHPREFTEESARALAKLADAGIPLGNQTVLLKGINDCAFIIKKLAHLLVSN
FT                   RVRPYYLYQCDLSRGIEHFRTPVSKGVEIMEALIGHTSGFAVPTFVVDAPGGGGKIPVL
FT                   PNYQLSSTSTKTVLRNYEGVICIYEEPANYNSSCSSTCNVCKGSSALHDPIGLQKLINP
FT                   NAKMVSLIPEGNRRKKRLKIYKDILHDN"
     atgaaacaaa aacttttatt tgcaaatatc acggaggaat ccaattggtc tgactggcgg        60
     tggcaattac gaaatcgcat catgtcatca gacgagttag atcagtatgc taatttgtct       120
     gtttatgaga aagccagcat tcaaaaagct attgatgtgt tcccaatggc tatcactcct       180
     tattatgcgt cacttataaa taaggatgat tcaacatgcc ctattcgcat gcagtgcata       240
     ccaaatccca aagagttaat taaaggttcc ggggacatgg atgatcctct gcatgaggat       300
     ggtgattcac cttgcccggg gctgacacac cgataccctg atagggtact gcttttggtt       360
     accaacgaat gttcgatgta ttgccggcac tgtactcgca agcgtaaagt tggcgataat       420
     gaaaaggttt cgaaagacag tgatattata aaggctattg aatacattaa agctcatcct       480
     gatatacgtg atgtattgtt atccggcgga gacccctttg ttttgtcaac caacagattg       540
     gagcaaatta tacgaagggt aagagaaatt ccgcatgttc aggtaattcg tattggaacc       600
     cgtacgccgg tagtaatgcc gcaaaggatc actgatcatt tggtcaaaat gcttaagaaa       660
     tatcatccta tctggataaa cacccacttt aatcaccctc gtgaatttac agaggagtct       720
     gcccgcgctc ttgccaagct ggctgacgcc ggtattcctc tgggtaatca aacggtgttg       780
     ctgaagggaa taaatgattg cgccttcatt attaaaaaat tagcgcacct gttggttagt       840
     aaccgtgttc gcccctatta cctttaccag tgtgatttat cccgcggcat tgagcatttt       900
     cgtactcctg taagtaaagg ggtggaaatt atggaggcgc tgattgggca tacctcaggg       960
     tttgcagtgc cgacttttgt ggtagatgcg ccggggggcg gggggaaaat accggttctg      1020
     cctaattatc aactgtccag cacaagtacc aaaacagtat tgcgcaatta cgaaggagtt      1080
     atctgcatat atgaagaacc ggcaaactac aattcaagtt gttcatccac ctgtaatgtg      1140
     tgtaaggggt ccagtgcttt acatgatcct atcggattgc aaaaacttat aaatccaaat      1200
     gctaagatgg tcagcttaat accggaaggg aacaggcgca aaaagcgttt aaaaatttat      1260
     aaggatattt tacatgacaa ttaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page