(data stored in ACNUC7421 zone)

EMBL: CP001720.PE556

CP001720.PE556       Location/Qualifiers
FT   CDS_pept        626297..627187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0601"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dde:Dde_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61521"
FT                   /db_xref="GOA:C8W666"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W666"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV61521.1"
FT                   /translation="MTINLRNMIENSQDRWEHLTGQAFQCSILISPYNKRITVYEFSLR
FT                   LDNGIEEMIQILTEKASEYQLDKIWLKARARWKEKFLRSKMKLEASIPGYYGGVETAMV
FT                   FAKYLTVRRETPSGLSNKNHAIKPVYNALRGTHSDSAVPHGVIIKQGEAANCRDLASLY
FT                   SKVFATYPFPIFNSDYLAHTMDQNVYYVLALYNNEIVAAASAEINTLDKNAEVTDFAVL
FT                   PEWRGRRLASCLLLHMEDVLKNTEIKCLYTIARSSSVGMNKVFANFGYGFGGVLINNCN
FT                   IGGGFEDMNVWSKVH"
     atgacaatta atttaagaaa tatgatagag aattcacaag accggtggga acatctaact        60
     ggacaggctt ttcaatgcag cattctcatt tccccctaca ataagagaat tactgtttat       120
     gaattttctc tgcgattaga caatggaata gaagaaatga ttcagattct tacggaaaag       180
     gcatcggaat atcaacttga taaaatatgg cttaaagcca gagccaggtg gaaagaaaaa       240
     tttttgcgca gcaaaatgaa gcttgaggca tctatccccg gctattacgg cggtgtcgaa       300
     actgccatgg tttttgccaa atatcttaca gtccggaggg agacaccctc gggattaagc       360
     aacaagaacc atgctataaa accagtgtat aatgctttga gggggacaca tagtgattcg       420
     gcggttcctc atggggtaat tattaagcaa ggagaggcag ccaattgccg agatttagcc       480
     tcattgtata gcaaggtttt tgctacttac ccttttccga tattcaattc tgattacctg       540
     gcacatacga tggatcagaa tgtctattat gttttagcct tatataataa cgagatcgta       600
     gccgctgcgt ctgctgagat aaacacatta gataaaaatg ctgaagttac tgattttgct       660
     gttctcccgg aatggagagg caggcgattg gccagttgcc ttttgctgca tatggaagat       720
     gtattaaaga atactgagat aaagtgtttg tacactattg cccgcagcag ttctgtcggt       780
     atgaacaaag tttttgctaa ttttggttat ggatttggcg gagttttgat caataattgc       840
     aatattggcg gcggttttga agatatgaat gtttggtcga aagttcatta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page