(data stored in ACNUC7421 zone)

EMBL: CP001720.PE558

CP001720.PE558       Location/Qualifiers
FT   CDS_pept        complement(627769..628095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61523"
FT                   /db_xref="GOA:C8W668"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W668"
FT                   /inference="similar to AA sequence:KEGG:BH3170"
FT                   /protein_id="ACV61523.1"
FT                   /translation="MHVFFPKLVLIFFTAFGIMIGATLMGSLAALLMKEPPVATMLSLA
FT                   KEIKIWAIVAAIGGSFSTFEILESGIFQGDLKAMVKQFFFILSSFSGTHLGYFVVVNLT
FT                   GGKN"
     ttgcatgtat tctttcccaa attagttctg atatttttta ctgcctttgg tattatgata        60
     ggcgccactc taatgggatc actggcagct ttgcttatga aggaacctcc ggtagcaacc       120
     atgctgtctt tggccaagga aattaaaatc tgggcaatcg ttgcagctat tggcggatct       180
     ttttcaactt ttgaaatctt agaatcaggg atctttcaag gtgacttaaa agctatggta       240
     aaacagtttt tctttattct cagcagtttt tccggcacac atttaggata ttttgtggtg       300
     gtgaacttaa ccggtggtaa aaattaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page