(data stored in ACNUC7421 zone)

EMBL: CP001720.PE559

CP001720.PE559       Location/Qualifiers
FT   CDS_pept        628486..629313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0604"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   bsu:BSU01750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61524"
FT                   /db_xref="GOA:C8W669"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:C8W669"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACV61524.1"
FT                   /translation="MDFSQLIKLGLPRISFSVTTLIDLMIVAFVVYRIYLLIKGTRAVQ
FT                   LIKGLIVLVVAMVVSDWIHLNTVNWLLRQAVTGLIVALPVVFQPELRRGLEKLGGGRFL
FT                   ARNVFMLAEEEKNTMIREVVRAVQMLAKNSIGALIVLERGTGLEEYVDTGTKIDGEISA
FT                   ELLVNIFIPKTPLHDGAVVVRGDRILAAACVLPLDESPNVNKALGTRHRAALGISEQSD
FT                   AMAVIVSEETGVISLAVEGGLIRYLDDISLAENLNKGLGGSTKLKFSTLWKFK"
     ttggactttt cgcaattaat taaactaggt ttaccccgga ttagtttttc tgtcactacg        60
     ttaattgact taatgattgt tgcttttgta gtgtaccgga tatacttgct gatcaaggga       120
     acacgtgcgg ttcaattgat taaaggattg atcgtgctgg tagtggccat ggttgtaagt       180
     gattggattc acctcaacac agttaactgg cttttgcgcc aggctgtaac ggggctgatt       240
     gttgctcttc cggtagtgtt tcagcccgag ctgcgcagag gtttggaaaa actgggtggc       300
     ggcaggtttt tagccaggaa tgtattcatg ctggcagagg aagagaaaaa cacaatgatt       360
     agagaggttg tgcgcgcggt tcagatgctg gctaaaaaca gtatcggagc cttgattgtt       420
     ttggagcgtg gtacaggcct ggaggagtac gttgacacag gtacaaaaat agacggcgag       480
     atatccgcgg aattgctggt aaacatattt ataccgaaaa cgccactgca tgacggtgct       540
     gtggtagtta ggggagatcg catacttgcc gctgcctgcg tgctgcccct ggatgagagt       600
     cctaacgtaa acaaagcctt gggtacgaga caccgggccg ctttgggtat cagtgagcag       660
     tctgacgcca tggctgtgat tgtctccgag gaaacagggg taatctctct ggccgtggaa       720
     ggcgggttaa ttcgctatct ggatgatatc agcctggcag aaaatttaaa taaaggactg       780
     ggaggcagca ccaagttaaa gttttctacc ttgtggaaat ttaaatag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page