(data stored in ACNUC7421 zone)

EMBL: CP001720.PE56

CP001720.PE56        Location/Qualifiers
FT   CDS_pept        63460..64119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0058"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: geo:Geob_0911 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61021"
FT                   /db_xref="GOA:C8VVF5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF5"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACV61021.1"
FT                   /translation="MVLEIKLFLDTANVEEIRDAYSLGVISGVTTNPSLIALEGRDFVQ
FT                   VVREIASIVDGPISAEAVSLEAAPMIEEARQLSSIHPNIVVKIPMTAEGLKAVKELSSQ
FT                   GIKTNVTLIFSANQALLAALAGASYVSPFVGRLDDIGYNGMQLIEEIMAIFNQYGLIAE
FT                   VIAASVRHPMHVIDAAKSGADIATIPYKVLYQMIKHPLTDSGIERFLKDWEKVPVK"
     gtggtgttgg aaataaaact ttttttggat acggcaaatg tggaggaaat aagagatgct        60
     tattcactgg gtgttatttc cggtgtaact actaatccgt ctttaattgc cttggagggg       120
     cgggattttg tccaggttgt gcgcgagatt gcctccattg tagacgggcc aatcagtgcc       180
     gaggctgtaa gcctggaagc cgcgcctatg attgaggaag ccaggcagtt atcctctatt       240
     catcctaata tagtagtaaa gatacccatg acagcagaag gtttaaaagc cgtcaaagag       300
     ttatcatccc agggaattaa aacaaatgta acacttattt tttcggctaa tcaggcactg       360
     ctggcagcat tggccggtgc atcgtatgta agcccttttg ttggccgttt ggatgacata       420
     ggttataacg gcatgcagct gatagaggaa attatggcga tttttaatca gtacggtttg       480
     attgcggaag ttatagctgc cagcgtccgg catcccatgc atgttattga tgcggccaag       540
     tctggagctg atattgcaac tatcccctat aaggttttat accaaatgat aaaacatcct       600
     ttaactgatt caggtattga aagatttcta aaagattggg agaaagttcc cgtaaaataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page