(data stored in ACNUC7421 zone)

EMBL: CP001720.PE560

CP001720.PE560       Location/Qualifiers
FT   CDS_pept        629443..630798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0605"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: bha:BH0267 phosphoglucosamine mutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61525"
FT                   /db_xref="GOA:C8W670"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W670"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACV61525.1"
FT                   /translation="MGVMFGTDGVRGVANRELTPELAFKLGRAGAYILCKDNCNDRRII
FT                   IGKDTRISGDMLEAALAAGICSVGVNVLKVGILPTPAIAYLTRSLGAAAGVVISASHNP
FT                   VEDNGIKFFGPTGYKLPDETEDSIETAVLGDFAGIPSPTGSALGRTYELKDALDRYIMF
FT                   LQDTMDVDLTGLKVVVDCANGAAYKVAPRVLKELGAEVIPIFNRPDGVNINAWCGSTYP
FT                   VALQESVVATGADIGLAHDGDADRLIAVDHEGNIVDGDRIMLTIAKYMKENDKLTRNTV
FT                   VVTVMSNLGLHLALQKAGIKVVQTKVGDRYVMEKMLKLGARFGGEQSGHIIFLKHNTTG
FT                   DGVLTALQLMRVMKKTGRSLKALGEQMERLPQLLENVRVADKAAIMNSPELSAAIEKYE
FT                   EQLAGQGRILVRPSGTEPLVRVMVEGRDKKELEQISAAMIKLIHELSQGGDR"
     gtgggggtaa tgtttggcac cgacggtgtg cggggagtgg ctaacaggga attaacaccg        60
     gaactggctt ttaaactggg ccgggccggc gcttatatat tgtgtaaaga taactgcaat       120
     gatcggagaa taatcatagg caaggatacc cgtatctcag gagatatgct ggaagcagcc       180
     ttggcagccg ggatctgctc tgtaggtgta aatgtcctga aggtcggaat tttgccaact       240
     ccggcgattg cgtatttaac ccgttccctg ggagcggcgg caggtgtggt tatttccgct       300
     tcccataacc cggtggaaga taacgggatc aagttttttg gccccaccgg ttataaactg       360
     ccggatgaaa cagaggatag catagagaca gccgttttag gcgattttgc aggtattcct       420
     tcgccgaccg gaagtgcttt gggccgtact tatgagttaa aggatgccct ggacaggtac       480
     atcatgttcc tgcaggatac tatggatgtt gatttaacgg gtttaaaagt agtggttgac       540
     tgtgccaacg gcgcggccta caaggtagcg cccagggtat tgaaagaact tggggctgag       600
     gtaataccta tttttaatag gcctgatggc gtaaatatta atgcctggtg cggttcaact       660
     tacccggtgg ccctgcagga atcggtggtt gcgacaggag cggacattgg cctggcacat       720
     gacggtgacg ccgacagact tatagccgtg gatcatgaag gcaatatagt agacggcgac       780
     agaataatgt taaccattgc taaatatatg aaggaaaatg ataaattaac cagaaatact       840
     gtagtggtaa ctgtaatgag taacctggga ctgcacctgg cactgcagaa agcgggcata       900
     aaagttgtgc aaacgaaagt tggtgatcgc tatgtgatgg agaagatgct taaattagga       960
     gccagattcg gaggagagca gtcggggcat attatattct taaagcataa taccaccggt      1020
     gacggtgttt taacggcctt gcagctgatg agagtaatga agaaaaccgg cagaagcctg      1080
     aaagctctgg gagagcagat ggaacgattg ccgcagctgc tggaaaatgt gcgtgtagcc      1140
     gataaagcag caattatgaa cagcccggaa ctcagcgcgg ctatagaaaa atacgaagag      1200
     caattagccg ggcagggcag aatactggta aggccgtcag gtacagaacc gctggtcaga      1260
     gtgatggtgg aaggcaggga caaaaaagaa ctggagcaaa tcagcgcggc aatgattaag      1320
     ctgatccatg aattaagcca gggaggtgat aggtaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page