(data stored in ACNUC7421 zone)

EMBL: CP001720.PE561

CP001720.PE561       Location/Qualifiers
FT   CDS_pept        631095..632921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0606"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: aba:Acid345_0997
FT                   glutamine--fructose-6- phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61526"
FT                   /db_xref="GOA:C8W671"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C8W671"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACV61526.1"
FT                   /translation="MCGIVGYIGTQEAVPILIDGLKKLEYRGYDSAGIAVLENGIRVEK
FT                   KVGKLAALEESLEGITFTAQTGIGHTRWATHGKPSDENAHPHTDCTGKFAVVHNGIIEN
FT                   YLHLRDRLKEEGHEFISETDTEVLPHLLEKYYRGDLVEAVRLVIQQLRGSYAMVVLCME
FT                   EPDKIVAARQDSPLVVGLGENENFLASDIPAILKYTKRALILEDGEIVVLTADKVTVFN
FT                   RSNHEVDKKVFEVPWKAEQAEKQGYEHFMLKEIFEQPKVLRDTVRGRISDDNSSVLLKD
FT                   ISLGREEIKKIKKLFITACGTAYHAGVVGKYVIEKLVRLPVEVDIASEYRYRDPIIDPD
FT                   SLVIVISQSGETADTLAALREAHRKGARVIAVTNVVDSSIAREADDVIYTWAGPEIAVA
FT                   STKAYTTQLIAMYLLALYFAEIRGTLQGSEINEILTSLRQVPGQVQEMLNDTAQIQDFA
FT                   GQYARHENAFFIGRGLDYTVATEGALKLKEISYIHAEAYAAGELKHGTLALIVENMPVV
FT                   ALATQPALLEKMISNIKEVHARGASIIGVALEGIAEMEEVSEKVIYIPRTHPVLTSVLT
FT                   VVPLQLLAYYMAVARGCDVDKPRNLAKAVTVE"
     atgtgtggaa tagtaggata tattggcaca caagaagctg tgcctatttt aatagatggt        60
     ttaaagaaac tggaataccg tggttatgat tcggcgggca ttgcagtttt agaaaatggc       120
     ataagggtgg aaaagaaagt gggtaagctg gcggctctgg aagaatccct ggagggtata       180
     acctttaccg cccaaacagg catcggacac acccgttggg ctacacacgg caagccttcc       240
     gatgaaaacg cgcacccgca tactgattgt acgggaaaat ttgccgtagt tcataacggt       300
     attattgaaa actacctgca tttaagagac aggttaaaag aagagggaca tgaatttatt       360
     tcagaaacag ataccgaggt tttgccgcac ctgctggaga aatattaccg gggggatctg       420
     gtggaagccg tgcgcctggt tatacagcaa ttgcgcggtt cttatgctat ggtagtgctt       480
     tgcatggaag agcctgataa aattgtggca gccaggcagg acagtcctct tgtggtgggc       540
     ctgggagaaa acgagaactt tctggcttcg gatattccgg ctattttgaa atataccaag       600
     cgtgccctaa tcctggagga tggggaaata gttgttctca cagctgataa agtaacggtt       660
     tttaatagaa gcaatcatga agttgataaa aaggtctttg aagtaccatg gaaagctgaa       720
     caggcggaga agcagggcta tgaacacttc atgctgaaag aaatttttga gcagcccaaa       780
     gttctgcgtg atactgtaag gggaagaatc agtgatgata atagctcggt gctgttaaaa       840
     gacatatcac tgggcaggga agaaatcaag aaaattaaaa aattgttcat tacggcctgc       900
     ggcactgcat accatgccgg tgtagtcggc aaatacgtca tagaaaaact ggttcgactc       960
     ccggtggagg tggatatagc ttccgagtat cgctaccgcg acccgattat tgatcctgac      1020
     agcttggtaa tagtgatcag ccaatcgggt gaaaccgccg atacgctggc ggcactgagg      1080
     gaagcacata gaaagggtgc tagggtaata gcggtaacta atgttgtgga cagttccata      1140
     gcgcgtgagg cggatgacgt gatttatacc tgggccggac cggagatagc tgtagcctct      1200
     accaaggctt atactaccca gctcatagca atgtatctgc tggctctgta ctttgcggag      1260
     attcgaggta cattgcaagg gtcagaaata aatgagatac tcaccagtct gaggcaggta      1320
     cccgggcagg ttcaagaaat gctgaatgat actgcacaga tacaggattt tgccggacaa      1380
     tatgccaggc atgaaaatgc cttcttcatt ggccgtggac ttgattacac ggtagctacg      1440
     gaaggcgcat tgaagctaaa ggaaatttcc tacattcacg ctgaggctta cgctgccgga      1500
     gaactaaaac acggtacact ggcactgatt gtggagaata tgccggtagt tgctctggct      1560
     acccagccgg cgctgctgga gaagatgatc agcaatatta aagaggttca cgcccgcgga      1620
     gcatcaatta taggtgtggc actggaaggc atagctgaga tggaagaagt ttcggagaag      1680
     gttatttata taccaaggac tcacccggta ttgacttcgg tgctgacagt agtgcccctg      1740
     cagctgctgg cttactatat ggcagtggcc cgcggctgcg atgttgataa accgcgtaat      1800
     ttggccaagg cggttacggt ggagtaa                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page