(data stored in ACNUC7421 zone)

EMBL: CP001720.PE562

CP001720.PE562       Location/Qualifiers
FT   CDS_pept        complement(633042..633503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61527"
FT                   /db_xref="GOA:C8W672"
FT                   /db_xref="UniProtKB/TrEMBL:C8W672"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61527.1"
FT                   /translation="MSFESLIQYIGAAIFFTILILLLIKRKDIKKFIPVGLFAILYADI
FT                   WCYIAEYLKIWSYPTRLFAQYTIVSIPFNYFALPVIVMVWIMFCPSSLKGKAIWALSWS
FT                   LFFISAEFGLTRYTKILAYTNGFDIHISFFLWLISWFIFYEFHVWINSK"
     atgtcatttg aaagcctaat ccagtatatc ggagcagcca tcttttttac tattctgatt        60
     ttgctgctga taaagcgaaa agacatcaaa aagtttattc cagttggctt attcgctatt       120
     ttgtatgccg atatatggtg ttacattgca gagtatttaa aaatatggag ctacccaacg       180
     cgattgtttg cccaatatac aattgtctca attcctttta attactttgc actgcctgta       240
     attgttatgg tctggattat gttttgtcca agcagcttaa aaggtaaagc tatttgggct       300
     ttatcctggt ctctattttt cataagcgca gaatttggat taacacgata cactaaaata       360
     ttggcttata caaacggatt tgatattcat atctcattct ttttgtggct tattagctgg       420
     ttcattttct atgagtttca tgtatggatt aatagtaaat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page